SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ005886|polyribonucleotide from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005886|polyribonucleotide
Domain Number 1 Region: 337-541
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.01e-41
Family Ribonuclease PH domain 1-like 0.0000694
Further Details:      
 
Domain Number 2 Region: 51-184
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.08e-37
Family Ribonuclease PH domain 1-like 0.0000847
Further Details:      
 
Domain Number 3 Region: 267-369
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 1.02e-23
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.00042
Further Details:      
 
Domain Number 4 Region: 496-600
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 1.44e-22
Family Ribonuclease PH domain 2-like 0.00018
Further Details:      
 
Domain Number 5 Region: 185-277
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 6.02e-22
Family Ribonuclease PH domain 2-like 0.0037
Further Details:      
 
Domain Number 6 Region: 604-672
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000935
Family Eukaryotic type KH-domain (KH-domain type I) 0.005
Further Details:      
 
Weak hits

Sequence:  CPIJ005886|polyribonucleotide
Domain Number - Region: 673-720
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00469
Family Cold shock DNA-binding domain-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005886|polyribonucleotide
Sequence length 759
Comment nucleotidyltransferase 1, mitochondrial|protein_coding|supercont3.111|603122|605455
Sequence
MLAHLRFLNSCGKSAKYVLGSVNSLNAGASNLRRLSSGLESPEVDISLSTGRVVRISSGK
YARFADGCSVVTVGDTAVMVTAVARQKPAGGSNASFLPLVVDYRQKAAAAGRIPTNFLRR
EMGPSEKEILAARLVDRSMRPLFPAEFRCDTQLVCNMLAIDSSNLPDVQAINAASAALSL
SDIPWNGPVGAVRVGLVDNEIIINPTRKELQLSALDLVVSATKQNLVVMLEGRGNIVNEN
ELRMAIKKGTQEAQLIINGIEKLQKSHGKPKRALEPLPQADEEIEAAVRTMSEMRLREIF
RDFSHDKFSRDQAVSKTRTDTIDKVWSSYPSVDPALIGECFNKFTKSVFREMVFEENRRC
DGRYLDDLRKISSSVNMHKPLHGSALFQRGQTQVFATVALDSQESALKLDPITSLDMGVK
SKNFFLHYEFPPYATGETGKIGPVGRREIGHGALAEKGLLPIIPNDNPFTIRLTAEVLES
NGSSSMATVCAGSMALMDAGIPVQEAAAGVAIGLMTKYENNDTKHLQDYRILTDLLGIED
YLGDMDMKVAGTRRGMTAIQADIKVPGIPLKVVMESLQKAMEARFKILDLMNESISTVRT
LKKDCWPVTDKLQIEPHQRSKLLGPGGINIRRLYLETGVQLSQEDENQFRIFAPSEAAMH
EAKEYLETLMKTEKVPDLEFGAIYTAKIVEMKDTGVMVTLYPSMSPALLHNSQLDQRKVS
EILMFGTGRLEDLKTRRLASIALAFSMARFLLEIWCLKA
Download sequence
Identical sequences B0WG77
7176.CPIJ005886-PA XP_001847711.1.94360 CPIJ005886|polyribonucleotide

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]