SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ005988|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ005988|conserved
Domain Number 1 Region: 121-335
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.13e-70
Family SPRY domain 0.00000000461
Further Details:      
 
Domain Number 2 Region: 324-363
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000889
Family SOCS box-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ005988|conserved
Sequence length 366
Comment hypothetical protein|protein_coding|supercont3.101|419999|424063
Sequence
MFFPSVPGLTRRPQISLPYKSSRGPVLRSSERRRPQSISSSTSTLLPRVVLNRIDPREFE
RIRVSYKVAIRSTRSSRSSSSVHPGMNMGQKISGGVKTVSSRDQPSPFIPKIPRELAAHF
QRPPRLDLLLDMPPVARETQVKYSWNSEDRSLNVFVKEDDKMTFHRHPVAQSTDCIRGKV
GFTKGLHVWEVFWSTRQRGTHAVIGVATSEAPLHSVGYQSLVGSNDQSWGWDLGRNMLYH
NSKTCPGVTYPAILKPDETFLVPDKFLVALDMDEGTLSFIVDGQYLGVAFRGLKGRKLYP
IVSAVWGHCEITMKYIGGLDPEPLPLMDLCRRVIRQKIGRTHLEERIEQLQLPQSMKTYL
LYRDRR
Download sequence
Identical sequences B0WF17
CPIJ005988|conserved XP_001847301.1.94360 7176.CPIJ005988-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]