SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ006032|coracle|protein_coding|supercont3.103|843206|854495 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006032|coracle|protein_coding|supercont3.103|843206|854495
Domain Number 1 Region: 277-409
Classification Level Classification E-value
Superfamily PH domain-like 5.23e-39
Family Third domain of FERM 0.00001
Further Details:      
 
Domain Number 2 Region: 173-278
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-32
Family Second domain of FERM 0.0000103
Further Details:      
 
Domain Number 3 Region: 93-171
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.62e-20
Family First domain of FERM 0.00067
Further Details:      
 
Weak hits

Sequence:  CPIJ006032|coracle|protein_coding|supercont3.103|843206|854495
Domain Number - Region: 1113-1292
Classification Level Classification E-value
Superfamily YWTD domain 0.00018
Family YWTD domain 0.023
Further Details:      
 
Domain Number - Region: 937-1084,1158-1228
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0115
Family Quinoprotein alcohol dehydrogenase-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ006032|coracle|protein_coding|supercont3.103|843206|854495
Sequence length 1720
Sequence
MPTTTSPSIKPVRFRFRLGGSDDDATLIDGSRGTHIRLNDQPTLAQIPQKDHVRCKLPRM
PGESKAAAPAAEPAAPATPKKKPASSSGKAALAKVTVLDGSILEVTIDRKARGRDLLNSV
CAGLNILEKDYFGLTYVTAVDPRVWLELERPIAKFFRSEPWEMNFEVKFYPPEPAQLQED
ITRYHLCLQVRNDILEGRLPCSFVTHALLGSYLVQSELGDYDADEMKDRTYLKEFKIAPN
QTPELLDKVMDLHKTHKSQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCAS
GLLVYRDKLRINRFAWPKILKISYKRNNFYIKIRPGEFEQYESTIGFKLENHRAAKKLWK
ACVEHHTFFRLMTPEPTNKSGIFPRLGSKFRYSGRTHYETRKTPVDRPAPDFKRSLTGKR
LSSRSMDALGHQEKEKAAQKDPNKDANKRHTMSHPPDHIPDLESPTRGSRSPIKKDKKER
LKRESSTGTASASSQSSLEGDYDIAASSSNAVQKPVGGVAVLPVVGKKDKEKEAKEVSPV
KEEAVNGNNGNQEALNSSTEEATSPSGKRKGGFLSFPSGRSKDKKTPVAAATTNGDGGAK
KDASSPVKEQTQAQGQKEGGKPGFTKPYEYSESDPNTSPNKKNVKTRGFRYDEDPSSGAG
GQNKEDAQLSPNSQSRRATGLAFNYAPGEDANVRESVEKRKVPGTPEAAVKASEKLSPTS
AGRGLAGEGDAEKGVRTSARSYSPNKGRGVDGALSGAGSFRPLDDGADPNKSFIAGEQQS
GIVPVVAGPPEPVKKKVKIMVIISRFDPKTKKVDTANGVVEHSTGVLDTKSGQIESKYGV
IDPKAGTVVNFNQRTGQNETFQGQTDPKTGQIHIVTGVVDPNTGKIDDNLGQAIIIVPDD
DSIVEITTITSKVDPATGKIDTTNGEVERTRGILNSKTGFIATKYGEINPKTGELRAVDP
KTGKIVVRTITVDKDNGQVTIVGVTDPKTNKIDNGQGHLIAIGNQVDPVVEVTSVLGKLD
KKGIVDPKTITYDKSTGQLDTKDGKINTKYGQFDLVKSTLTSVDPKTGKTETKEVKIDPV
TGQVVLKNQVNPKTGKPDKDYGRIVSIRIVHNRIDPASGKHVSSVEDKDIKVDPKTNQIW
VPEGKDKSTGETIYSSSQVDPKTGYVITIYGYLNPKTNEIEKQTKLDPNLTKVDPTTGQI
YAATGQVDEATGEPLFAASQVNAETGEIYTKIGKVDPKSGKLVIIKIFILTKKDERGKPE
EVDVNGVDFDPITGKINNIATKTVYVYKMRDPITGETYAVDPNDPSIAGARTTVTQTMTL
SGEIDPATGRIKSEWGHIDPNTGDIDPATAIRDPVTGKLILNYADIEPSHFGKNVTVTKE
TVPITREQFYEGIKHLGGKKAVRRDSESSDDDMAEYGSESIKEMSSGTPRNAAAAAAAGG
KYGGTPTVVKTTTKQVITKNEDGVTHNVEEEVQNLGTGQIVYSTQEHKADAPSDSHGKFL
TATAVTTRTATTHEDLGTNAKTQQLEEKTVATTTTQHGERQEQRVITQEVKTTATVTSGD
QYARRESISSTSSGDSGTPIDGPYGEEDDSTVIYNKSYTGVDDVAGASKIPTGPNVEHHR
VLLDDSQSGVTAEGEIVSSQTVSSKTRTVETITYKTERDGVVETRVEQKITIQSDGDPID
HDKALAEAIQASRRFRTDPEERMRQLSNAMFERKYNFPKF
Download sequence
Identical sequences B0WF91
CPIJ006032|coracle|protein_coding|supercont3.103|843206|854495 7176.CPIJ006032-PA XP_001847375.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]