SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ006311|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ006311|conserved
Domain Number 1 Region: 100-397
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 2.78e-34
Family NodB-like polysaccharide deacetylase 0.034
Further Details:      
 
Domain Number 2 Region: 29-89
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 7.06e-16
Family Tachycitin 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ006311|conserved
Sequence length 490
Comment hypothetical protein|protein_coding|supercont3.120|469489|498270
Sequence
MKLLLVVVLLSAVVALVTAQTKEEKEFKCPEGYGNGNFADPATCRRFYQCVDGYPYVNRC
PSGLYFDDVQKFCTFKAEAKCGPLPNQPPATTEAAVDLAKRCDPAECELPYCFCNKDGTL
IPKGLNADEIPQIILLTFDGAVNLNNYEHYKKVFNGKRQNPNGCDIKGTFFISHEYSNYQ
QIQVLANGGHEIAVETISLQQGLQDKGYEEWVGEMIGMRSILKHFSNVSSNEINGMRAPF
LKPGRNTQYKVIEDFGFIYDSSISVPPSPIPMWPYTLDYKIPHECKSGTCPTKSFPGIWE
VPLNAHFVESYEGGHCPYMDQCVLHNHDANEVFHWLQEDFERYYYQNKAPYMMPFHTNWF
QIKELEGGLHKFLDWTQTLPDVWFVTVTQALTWITDPKTLNQLNNYEPWNCKVKSTQTPK
PCNISNKCALAFKEPTSNISDTRYMETCFECPAVYPWLGDSHGSGIPGRDNYIDQSEAGE
GKGGSSDDEN
Download sequence
Identical sequences B0WH33
XP_001848017.1.94360 7176.CPIJ006311-PA CPIJ006311|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]