SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ007754|rac from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ007754|rac
Domain Number 1 Region: 195-516
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.5e-96
Family Protein kinases, catalytic subunit 0.000000000557
Further Details:      
 
Domain Number 2 Region: 39-144
Classification Level Classification E-value
Superfamily PH domain-like 3.75e-24
Family Pleckstrin-homology domain (PH domain) 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ007754|rac
Sequence length 544
Comment serine/threonine kinase|protein_coding|supercont3.162|252898|275831
Sequence
MSSSDATNNSQQQQPTMAPATAAASVPISQPTRVTQPPPATIIKEGWLYKRGEHIKNWRS
RYFVLKDDGTLVGYKNRPDASFQAEPSNNFTVRGCQIMSVDRPRPFTFIIRGLQWTTVIE
RMFHVEEEKERQEWVEAIRSVANRLTEAEAYQGGAGPGESNEDVEMASIAEDELLTEKFS
VQGTSTGKISGRKKVTLENFEFLKVLGKGTFGKVILCREKTTAKLYAIKILKKEVIVQKD
EVAHTMAENRVLKRTNHPFLISLKYSFQTVDRLCFVMQYVNGGELFFHLSRERVFSEDRT
RFYGAEIISALGYLHSHEIVYRDLKLENLLLDKDGHIKIADFGLCKEQITYGRTTKTFCG
TPEYLAPEVLEDNDYGLAVDWWGTGVVMYEMMCGRLPFYNRDHDILFTLILMEEVKFPRN
ITANARDLLTGLLMKQPKDRLGGGPTDAKEIMVHPFFSSINWTELYQKRIPPPFKPLVTS
DTDTRYFDSEFTGESVELTPPDNNGPLGAIQEEPHFSQFSYQDMASTLNTPSFMNNPNSY
VSMQ
Download sequence
Identical sequences B0WKM3
XP_001849257.1.94360 7176.CPIJ007754-PA CPIJ007754|rac

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]