SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ011714|laminin from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ011714|laminin
Domain Number 1 Region: 730-778
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000558
Family Laminin-type module 0.005
Further Details:      
 
Domain Number 2 Region: 243-295
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000112
Family Laminin-type module 0.057
Further Details:      
 
Domain Number 3 Region: 988-1038
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 836-887
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000363
Family Laminin-type module 0.036
Further Details:      
 
Domain Number 5 Region: 776-828
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000162
Family Laminin-type module 0.004
Further Details:      
 
Domain Number 6 Region: 885-932
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000022
Family Laminin-type module 0.002
Further Details:      
 
Domain Number 7 Region: 937-985
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000053
Family Laminin-type module 0.0055
Further Details:      
 
Domain Number 8 Region: 682-723
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000112
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1282-1306,1341-1555
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.000000116
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.014
Further Details:      
 
Domain Number 10 Region: 180-232
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000126
Family Laminin-type module 0.033
Further Details:      
 
Domain Number 11 Region: 417-455
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000184
Family Laminin-type module 0.0066
Further Details:      
 
Domain Number 12 Region: 1036-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.0098
Further Details:      
 
Domain Number 13 Region: 331-368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000053
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 14 Region: 366-409
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family Laminin-type module 0.0061
Further Details:      
 
Weak hits

Sequence:  CPIJ011714|laminin
Domain Number - Region: 1542-1669
Classification Level Classification E-value
Superfamily Tropomyosin 0.00981
Family Tropomyosin 0.011
Further Details:      
 
Domain Number - Region: 21-88
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0213
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ011714|laminin
Sequence length 1682
Comment subunit beta-1|protein_coding|supercont3.387|356773|363204
Sequence
MSYRPFQMLLQKSDWCTLEQSWWQSENGKENVTIQLDLEAEFHFTHLIIVFATFRPAAML
IERSYDFGKTWHVYRYFAHNCREAFPNSLSVAKNITDVICDHRYSSVEPSKNGEVIYRVL
PPMNIENPYAEHVQNMLKMTNLRINFTRLHTLGDTLLDDRQEIQEKYYYAISNMIVRGSC
SCYGHASRCLPLEGVRNTIDMVHGRCECTHNTKGLNCEECEDFFNDLPWKPALGKQTNAC
KKCHCNNHATSCHFDQAVYEHSGRVSGGVCDNCQHNTQGYHCEECAPFFYRDPVEDIQSP
YVCKPCDCDPRGSLDDGICDSFGDEESDVEAGACHCKRNVNGRRCDQCKEGFWSFDESNP
DGCQPCSCNILGTVDNAGCNVHTGECICKRLVTGRDCNQCIPETYGLSDSPEGCTPCACH
PGGSLDNQCDVITGQCRCRPHMQGRDCAEPKQHYFIPTLHKVLEAEFPGTICDHYSSVGN
CSVVIREHPHDRQPSWTGPGFIRAHEGTELKFTVDDIPKTMNYDVVVRYSPQMKGDWEDI
RMSVIRPDDYNPDGPCANSHPNYERDIHTTLSEYESSAVAMHDVCLETGKTYKFIVSFQR
HNPYDDNPAAQILIDSIVLVPRIEVTPIFHGTPQADLRYREYKDLGCNQTYYDVNYDASA
RPECKDLLNTVSVFVFNGATPCECNPTGSTTKKCDEFGGYCACKSNVVGRQCDKCAPGTY
GFGPEGCKACDCNSIGSKDNDCDLVTGQCSCHPNTYGRECDQCQPGFWNFPNCQMCECNG
HTSTCNSKTGECHSCQDYTRGWKCDRCLEGYYGNPLLGSEIGCRPCRCPDTIASGHSYAN
ECLLDPKTNDVICLCDQGYAGAKCDVCADNYFGNPERPGGTCQPCDCSNNVDLNQPGNCD
AKTGKCQQCLYETEGDHCEFCRDGYYGDALQQDCRPCDCNVLGTNQTIQHCDRHTGQCPC
LANVRGQYCEECIENHWKIASGEGCEQCGCDPVGSVNEQCNPYDGQCTCKQGFGGRQCNQ
CEANFWGNPNVQCNPCDCNVYGAATRQCNRETGQCVCNPGIGGYKCDQCARGYLGDAPYC
EPCGECFDNWEIILDGLREETNRTIEEAKTIKTLGATGAYKKEFDSMSKKIEVIQGLLTN
TISDREIEAINANIADVKQHLSESAKAVEASEKRLQETSANIKFANIDIEELSKKAEEVK
QLANYLRENATKLQEGNIEGALNLTRDAWNRVTQLGETNMEIQELNDNAERQCKRTEVLL
KKNQDNIDNQNENIEAAFLKYRDELDTLNGNIPDLNERICDRRGDPCDEICGGAGCDGKC
GGITCDKGALTRSEKALSYAKKTEQTIKEKEELADDILRSMSQAKTNASEAFKKAKRAHD
KAQAHYNFTQDLIESANHVVTNLTDIIDNNTATPEKIRELAEQIQQYTLQLQPDQIQTLA
EQIDEAVSHLENVESIIRNTEHDLERVEQLKDYALDTKNRAEKVLEDALDVTNALDDADE
AQKKARQSIKRANEDIQSAKIDLEEIDKETDDAHNRANVTAGKVDELKTRLNKLHVSNVQ
NQQDAEEIIKQAETVKESANNAHDLATQLKDTYKTANATLTARSNASESARERAQNLLNR
ASKITVETTNQLKKLQELHKTYESNQKDLDSLESKIQGLTEQINTHLNKIQSDADRYRQC
TT
Download sequence
Identical sequences B0WYV5
CPIJ011714|laminin 7176.CPIJ011714-PA XP_001862577.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]