SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ012632|insulin from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ012632|insulin
Domain Number 1 Region: 208-289
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-19
Family Homeodomain 0.0000783
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000812
Family LIM domain 0.016
Further Details:      
 
Domain Number 3 Region: 23-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000107
Family LIM domain 0.022
Further Details:      
 
Weak hits

Sequence:  CPIJ012632|insulin
Domain Number - Region: 117-145
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0173
Family LIM domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ012632|insulin
Sequence length 438
Comment protein enhancer protein isl|protein_coding|supercont3.386|265172|298274
Sequence
MAVLQSHKLGEHNVPGLSREKERLSLCVGCGTQIHDQYILRVAPDLEWHAACLKCQECHQ
FLDESCTCFVRDGKTYCKRDYVRLFGTKCDKCGNSFSKNDFVMRAKSKIYHIECFRCSLC
MKHLQPGDEFALRDGGALYCKEDHDHLEKTSQSLGPGVEPNNNVSNANANQNSSSNNNNN
NNSSSNNNNNISLSNNNHSSELGSMSDSGSESGSHKSMRGKGPTGPSDGKPTRVRTVLNE
KQLQTLRTCYNANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKTIQMKLQMQQE
KVPQLLYYSSSPEGRKLGYGMQGIPMVASSPVRHDSPLNLHGLEVTAYQPPWKALSDFAL
HSDLDSNGAINTHTPAFQHLVNQMHGYDVGGGGGMHQMGPQGGQGPLMGSHMDMSGYHHP
DSTDSYVYASDDSMQGSP
Download sequence
Identical sequences B0WYT4
CPIJ012632|insulin XP_001862556.1.94360 7176.CPIJ012632-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]