SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ013309|lim from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ013309|lim
Domain Number 1 Region: 198-263
Classification Level Classification E-value
Superfamily Homeodomain-like 2.18e-20
Family Homeodomain 0.0013
Further Details:      
 
Domain Number 2 Region: 92-156
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000635
Family LIM domain 0.013
Further Details:      
 
Domain Number 3 Region: 61-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000132
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  CPIJ013309|lim
Domain Number - Region: 153-183
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00928
Family LIM domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CPIJ013309|lim
Sequence length 456
Comment homeobox protein|protein_coding|supercont3.474|343621|351790
Sequence
MEMLKLMMDTSDYMANLASSVNNNNNNEISKKDLLHQQRSPSPEYRVPPINLDELPEALL
STIPKCGGCHELILDRFILKVSDRTWHAKCLQCSECHVQLNEKCFARNGQLFCKDDFFKR
YGTKCAACDLGIPPTQVVRRAQDNVYHLQCFMCSMCSRQLNTGDEFYLMEDGKLVCKPDY
EAAKAKGLYLSDGSLDGESSNKRPRTTITAKQLETLKSAYNSSPKPARHVREQLSQDTGL
DMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGSSPGRHDKLLDKDELKIDLDSF
SHHDLSNDSYSTSNMGLEDGASPHSGRGSYIHGSGSPPPYLSSHSPPPMGPGHHYGSYPD
NIVYTPLGQPVTSMHPGGPHGGRLHGSGVSDMSNDSSPAHGYPDFPPSPDSWLGESCQNG
QPGVAPPPPPPPTLPQTNGGAVGVAAVAAVAAALHY
Download sequence
Identical sequences B0X2D6
CPIJ013309|lim 7176.CPIJ013309-PA XP_001863808.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]