SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ014551|D7 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ014551|D7
Domain Number 1 Region: 165-263
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000034
Family Insect pheromone/odorant-binding proteins 0.0055
Further Details:      
 
Domain Number 2 Region: 25-97
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000114
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ014551|D7
Sequence length 313
Comment protein|protein_coding|supercont3.618|185253|186507
Sequence
MNFVGISSLVIVAFFAGGNAAWKPFSPEETLFTYTRCMEDNAKGDLALAKKWMAWKLEAD
QKSACYAKCVLVGLELFDESSKTFKGDHIVEQYQKYKSYTSQDEAGVKKFQQAVQALGTI
DSANCLKVLQKYGPVHAQFTDVQRNVYFGKKEITDKIYNSDYTVKKRDETMFRFCERSNF
KDGSEELCTLRKTGITTNNNHLDCLFRGLRYLDRNGNINPDEIKRDLHFINVKDKDAAVD
NALNNCKVKEATKATDYNDCLWKDPNLKDIMMPVFDYREVRSESYRYFIENTDPYDVAKV
KEKVKKYDKDAGC
Download sequence
Identical sequences B0X6Z1
CPIJ014551|D7 XP_001865413.1.94360 7176.CPIJ014551-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]