SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CPIJ016346|conserved from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ016346|conserved
Domain Number 1 Region: 37-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000038
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 2 Region: 73-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ016346|conserved
Sequence length 169
Comment hypothetical protein|protein_coding|supercont3.758|99227|118525
Sequence
MAGGELFRLMAPMLRTRNHVQTFLSKARVRYGVAAETACSDDKFRCKSGRCIPKHWQCDG
ENDCSDGSDEDSEKCHNKSCPSNEVMCKTGDRCIPRAWLCDRDPDCPDGSDEKECITCDN
REKTNFTLQFREFPSSSSCKVSPGSSPSWDPVNRKHKIPSPNLAHKFIL
Download sequence
Identical sequences B0XA73
7176.CPIJ016346-PA XP_001866545.1.94360 CPIJ016346|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]