SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ017227|phospholipase from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ017227|phospholipase
Domain Number 1 Region: 224-436
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 8.79e-33
Family Phospholipase D 0.025
Further Details:      
 
Domain Number 2 Region: 60-215
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.28e-22
Family Polyphosphate kinase C-terminal domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ017227|phospholipase
Sequence length 533
Comment D3|protein_coding|supercont3.892|63620|65610
Sequence
MILLLIVMVVLLPLLDTNEKLADQRRKTARSRNDVCLEGCRISLVESIPEGLVYPKGSPS
FMSTYDAWKLLIKSAQQKIEIGSFYWSLRREDVYNHSSAWQGEDIFKTLLETGTSGNVSI
KIAQSMPTSANPSVDTEIFTKRNAADVRSVDFPRLFGGGVLHTKVWVIDRRHFYVGSANM
DWRSLTQVKELGVLAVNCSCLATDIAKIFDVYWDMGVPNAQLPDQWPAAYSTKYNANNTL
SVQFDDEYKVDTYLSSSPPPMSTRGRTHDVDAILDVIERAEKFIHISVMDYLPLTLYTPK
TQFWPIIDDALRRAAIDRKISIRLLISLWAHSRSSEQRFLDSLQVISNSLPGVSIDIKRF
IVPADDDQQKIPFARVNHNKYMVTDNTAYIGTSNWSGDYFIDTAGIGLVMSSYEGNRTIV
NDLQDVFERDWNNCAAVGEVSFVLFTHVPSQSSLMNVRSGTLLALECFHTGVLKHMGIES
VLQRERKRTHRTFVGTIFGMNAHVTLEKTFLPESLATVLTVKTFLRIVISYMN
Download sequence
Identical sequences B0XCL7
CPIJ017227|phospholipase XP_001867389.1.94360 7176.CPIJ017227-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]