SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ018010|vasorin|protein_coding|supercont3.1081|112747|117242 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ018010|vasorin|protein_coding|supercont3.1081|112747|117242
Domain Number 1 Region: 376-696
Classification Level Classification E-value
Superfamily L domain-like 2.31e-49
Family Ngr ectodomain-like 0.018
Further Details:      
 
Domain Number 2 Region: 67-419
Classification Level Classification E-value
Superfamily L domain-like 7.14e-47
Family Internalin LRR domain 0.018
Further Details:      
 
Domain Number 3 Region: 1073-1216
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.79e-44
Family Toll/Interleukin receptor TIR domain 0.0000415
Further Details:      
 
Domain Number 4 Region: 799-941
Classification Level Classification E-value
Superfamily L domain-like 4.69e-28
Family Ngr ectodomain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CPIJ018010|vasorin|protein_coding|supercont3.1081|112747|117242
Sequence length 1332
Sequence
MRTSPALLSVLFGTIFGVFGASLSKSLLSQAPDECRWSGYSEDDLTLVCRLRTINSELEN
TNFSVLHPENTVRLRLQCNDGLFFQSSISPGSFRQLSELRSLSIEFCKIANLSDGSFRGL
GKLTNLTLRTHNTDWSSVSLEVAPHVFNAELSKLERLDLSQNNMWSLPDGMICPLTKLEY
LNLTQNRLRDLSVFHFSASLSTRLSKKCGSTITTLDLSHNNIDNLPPAIFSGLGKLTELR
LQSNGLNFIADRALEGLISLSKLDISLNRLSNLPPELFSEAKHIKEIYLQNNSINVLAPG
IFSELQQLLVLDLSNNELTSEWVNSATFKGLSRLILLDLANNKISKLEPAIFRDLYSLQI
LRLQDNFIESIQENTFSELTALNTLVISNNRLSNIEYFTFQGLNRLALLSLDYNRISRID
RVAFKNLSTLQDLHLNGNKLLQVPDALYDVPLLRTLDLGENHISNIDNASFKDMIHMYGL
RLTENNIETIRKGTFDAMKSLQILNLSKNRLKRVEQACFDNNTNLQAIRLDGNYLTDIAG
LFTKLPNLVWLNISDNHLEVFDYALIPTGLQWLDIHANKIAELGNYFEIESQLALSTIDA
SSNQLTEITGSAIPNSVELLYLNDNLISKVQSYTFFKKPNLTRVDLFGNKITTLDPNALR
ISAVPDDKPLPEFYIGGNPYQCDCNLNWLQKNNVDSRTQPKLMDLDSIYCKLLYNRGRTY
VPLVEALPNQFLCKYETHCFALCHCCDFYACDCKMECPARCTCYHDQSWTSNVVDCSRAG
YDEKLPDQIPMDSTQIYLDGNNFKTLASHAFLGRKKLKILFLNNSNVEVISNRTFYGLKE
LEILQLNHNQITELNGFEFVGLDRLKELFLQYNRIATIANQSFDHLHNLRILRLDHNRIV
EFNMWHLPKQLTDVRLAANSWSCDCEYVERFREYLKTFEFVKDRMKIKCATITLPGNETA
LVVNGTSVTEPVRVVPEGAEGFLVYFDNSTTLCSGAIPLDNVINGNLTSRKTVLSPAPIE
GYIPLLVAALCGFSVIIIVTLIVFVFRQEMRVWFHSKFGVRLFYRNSDMDKNERDKLFDA
FVSYSSKDEAFVAEELAPLLENGDPSYKLCLHYRDFPVGAYIADTIVQAVESSRRTIMVL
SENFIKSEWCRFEFKSAHHQVLRDRRRRLIVILLGEVPQKDLDPDIRLYLKTNTYLQWGD
KLFWEKLRFALPDVPNNQRRRQQQPPINMTHSNIRNQYQLTRTPNNRSNNQMMMQQQPLP
PQPDPRLRPELPINVGQQQQQQQQQQVPQHQRQQELQQQQQVQNQQRSSPRTYKEDRCLC
RVCPRGGSAPPE
Download sequence
Identical sequences B0XF31
CPIJ018010|vasorin|protein_coding|supercont3.1081|112747|117242 7176.CPIJ018010-PA XP_001868253.1.94360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]