SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ018307|myd88|protein_coding|supercont3.1177|79168|80592 from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ018307|myd88|protein_coding|supercont3.1177|79168|80592
Domain Number 1 Region: 163-302
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-22
Family Toll/Interleukin receptor TIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 21-117
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000033
Family DEATH domain, DD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ018307|myd88|protein_coding|supercont3.1177|79168|80592
Sequence length 435
Sequence
MQPTTVEVTDVDRINLGEIPVSVLRQATFKLLAVLLNKKKIFKSEDGYYRDWRGLFQAIP
LENHYIAEVEADADPCKKIFELWKIKATKEGKVPSLLELQNILGIIDRWDVVDDSNKLFR
EDAEQYLAEKQRVHLPISANQLIETEQLSNNQQVADDDIITKDDTIYKKQIYDAFVLFAD
ADIEFASKIVHKMEERNLKLCLKDRDVLAGISFEHNVLVKLISERCNRLIVVFSKEFLKS
PLNEFVVTYAQAMQIEQKLRKILPCVYERIELPPALKYTTILDYKRSEHLFNYWDKLESS
IKVRKDPPKPAEVKTPSAPAMSVPEIKVDPIDEPVAPKRKPQPQIQPQLPTTTMALTTPS
EPTLKTKSVSLRDISATMNRLLNSKSAETSASTSELCVKPEKKERKLLDRLKIGRLMPKK
SGESKSKKKKLAEAS
Download sequence
Identical sequences B0XG49
CPIJ018307|myd88|protein_coding|supercont3.1177|79168|80592 XP_001868621.1.94360 7176.CPIJ018307-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]