SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CPIJ019602|odorant-binding from Culex pipiens quinquefasciatus

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CPIJ019602|odorant-binding
Domain Number 1 Region: 123-231
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000706
Family Insect pheromone/odorant-binding proteins 0.016
Further Details:      
 
Domain Number 2 Region: 32-129
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000863
Family Insect pheromone/odorant-binding proteins 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) CPIJ019602|odorant-binding
Sequence length 348
Comment protein|protein_coding|supercont3.1806|12057|13103
Sequence
MNSLPTLLLLTITSVLSANHNLVQKSVCRANRECYQYLRGSPECGARCQQIVLRAWDDNT
GLDTVPYGRHFQPDCRDQLYKNRTDQCIECQRGSSPREDHCRRSAIAFGCYRDQYGELLK
TPQVVPMPDLLLRSTVEQCAQILQISDRQIADANLHLTPAGHRLMRCVIIREGFYSDADG
PYLDRLYVQCGGYQRGEAAFKRHFQACHKRILTQKPNAPTLASKLATECIPRSSPNQRDV
VPSSNPSIELPAGTSPASCRATQMVVCASSCNNFAIARQCSSSSIVGPIQLSIILASFPR
ENGFPITGPLIQTLPAEARSCIVNQFRYCRTNCLPEAIERNCHAAEMD
Download sequence
Identical sequences B0XJU9
XP_001869921.1.94360 CPIJ019602|odorant-binding 7176.CPIJ019602-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]