SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PABG_00718T0 from Paracoccidioides brasiliensis Pb03

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PABG_00718T0
Domain Number 1 Region: 130-320
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-35
Family Hypothetical protein AT3g04780/F7O18 27 0.00084
Further Details:      
 
Domain Number 2 Region: 3-107
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.61e-31
Family Thioltransferase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PABG_00718T0
Sequence length 339
Comment | PABG_00718 | Paracoccidioides brasiliensis Pb03 conserved hypothetical protein (340 aa)
Sequence
MSKIAHVSSQKQFSELLASSPIVVADFYATWCGPCKVIAPVFEQLATKFGRPNQVSFIKI
DVDANAEVAAACGITAMPTFLIFKNGNVAHSIRGANAQLLTAKIQEIASSGSNDSGADGA
EGESSSIGAHWLGGNVPRGYSELSNEIEIKGIDLLNCDNEIGSGRSLFAPEQPSGLSASA
ESGGNGKAKDAATRDWVESDTDEQLMLYVPFQSSVKIHSLQITSLPPSGGDDGDEVPMRP
KTLKLYTNRTHIIGFEEADEETPTQEIELAPRDWEAKTGTATVELRFVKFQRITSLVVYF
VDGDGDGERIRVDRVRVFGEAGEKREMGKLEKIGDELGE
Download sequence
Identical sequences C0RZ63
PABG_00718T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]