SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000002182 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000002182
Domain Number 1 Region: 1148-1343
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.1e-57
Family BCR-homology GTPase activation domain (BH-domain) 0.0000236
Further Details:      
 
Domain Number 2 Region: 954-1061
Classification Level Classification E-value
Superfamily PH domain-like 2.11e-26
Family Pleckstrin-homology domain (PH domain) 0.00000172
Further Details:      
 
Domain Number 3 Region: 40-165
Classification Level Classification E-value
Superfamily PDZ domain-like 6.57e-20
Family PDZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000002182   Gene: ENSTSYG00000002340   Transcript: ENSTSYT00000002376
Sequence length 1961
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_1886:15240:104585:-1 gene:ENSTSYG00000002340 transcript:ENSTSYT00000002376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRRTGLPEGDGDKLKACGAPACEVSKSKDGKEQSETVSPSEDETFSWPGPKTVLLKRT
SQGFGFTLRHFIVYPPESAIQFSYKDEENGNKGGKQRSRLEPMDTIFVKQVKEGGPAFEA
GLCTGDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALA
YSQDAYLKGNEAYSGNARNIPAPPPICYPWLPSASTATAQPVEISPLDSSLSKQQTSTPV
LAQPGRAYRMEIQVPPSPTAAAKSNTAVCVCNESGRTVIMPSEKAVDLLSSRNNHTGPSH
RTEEVRYGMNEQTSLKTASRTTSPPSSVPTAHLIHQTTGCRSLEPSGILLKSGNYSGPSE
GVSSSRIQAVDSPSVPVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLR
AASQSTADYNQVVPSRTTLQVRRRSTSHDRVPQSAQIRQRSVSQERLEDSVLMKYCPRSA
SQGALTSPPVSFSNHRTRSWDYIEGQGDTLEHVNSESQTPDSNGERKQTYKWSGFTEQDD
RRGIHERPRQQEIHKSFRGSNFTVAPSVVNSDNRRVSGRGMGSGSQFKKVPPDLKTLQSN
RSFQSTCGMSVPRDISQDRSPLVKVRSNSVKAPSTHVTKPSFSQNSFVSIKDQRPVNHLH
QNSLLNQQTWVRTENATDQQVESRKSPSLSGASTKPPPQMSENSGTSDLELSVSQRNQDL
NSQDPEIQQSHTLDSKETVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPND
ARREVQIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHISASAVISASTSQVP
SIATVPPSLTTSAPLIRRQLSHDHETVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLS
FKHVSSLKGIKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVGGSIR
PWKQMYVVLRGHSLYLYKDKREQMTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDC
ECLFQAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNSLMSKAEQLPKTPR
QSLSIRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFE
KKPTATGTFGVRLDDCPPAHNNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQ
EELNKGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRL
KTLKRLIRDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTH
MVTHMPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEENTVDSQPVPNIDHLLTNIGRTG
VSPGDVSDSATSDSTKSKGSWGSGRDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDE
LDNVFFKKENMEQCHNDIKGEKKESETLGRKQRITSAKENTSRKDPSAAKDEKMSLRKES
TPSEEPSPPHSTKLSKSPTLSCRFTILKESPRSLLTQKSSHFEETGSDSGTLLSMSSQAS
LARFSMKKSTSPETKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGD
EADDERSELISEGRPVETDSESEFPVFPTVLTSERLFRGKLQDISKTSRRNSEGSEVSCT
EGSLTPSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKTEKETPSITKVFDVM
KKGKSTGSLQTSTRSDSEKQEPTWKTKIADRLKLRPRAPADDMFGVGNQKTNAETAKRKN
IKRRHTLGGHRDATEISVLNFWKVHEQGGERESELSAVNRLKPKCSAQDLSISDWLARER
LRTSTSDLSRGDTGDPQPENPSSLEASTTDTPLSFQSDTGSSSSTLASTSRHLLSIPPQS
PDQINGESFQNMSQNASSAANAQPHKLSETPGNKAQFHPCL
Download sequence
Identical sequences ENSTSYP00000002182 ENSTSYP00000002182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]