SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000002932 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000002932
Domain Number 1 Region: 3118-3277
Classification Level Classification E-value
Superfamily C-type lectin-like 2.45e-40
Family C-type lectin domain 0.00000693
Further Details:      
 
Domain Number 2 Region: 152-257
Classification Level Classification E-value
Superfamily C-type lectin-like 2.91e-40
Family Link domain 0.0031
Further Details:      
 
Domain Number 3 Region: 252-351
Classification Level Classification E-value
Superfamily C-type lectin-like 8.44e-28
Family Link domain 0.0044
Further Details:      
 
Domain Number 4 Region: 3075-3116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000661
Family EGF-type module 0.009
Further Details:      
 
Domain Number 5 Region: 3278-3336
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000876
Family Complement control module/SCR domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000002932   Gene: ENSTSYG00000003176   Transcript: ENSTSYT00000003207
Sequence length 3380
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_300:8957:108758:1 gene:ENSTSYG00000003176 transcript:ENSTSYT00000003207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLINMKSILWLCSTLVAAHALHKVKVDKSPPVRGSLSGKVSLPCYFPTMPTLPPSYNTSE
FLRIKWSKIEVDKSGKDLKETTVLVAQNGNIKIGQDYRGRVSVPIHLEVVRDASLTMGKL
LASXXXXXXXXXXXXXXXXXXXXXXXXXXVEFHYRAATSRYTLNFEAAKKACLDIGAVIA
TPEQLLAAYDDGFEQCDAGWLSDQTVRYPIRAPREGCYGDMMGKEGVRTYGFRSPLETYD
VYCYVDHLDGDVFHITAPHKFTFEEAAEACGDQEARLATVGELHAAWRNGFDQCDYGWLL
DASVRHPVTVARAQCGGGLLGVRTLYRYENQTCFPPPDSRFDAYCYKPKEATIIDLNIFA
ETASPSLSREPQVVSARTMPAITLVSDLPVGTTKFPPVGNIVNFEEKVTVQPQVVTEGAA
TELPTPAAGTKEPWELDYYLPSASGPLGKPDTSEIKEEGLQSTTIIPHHATDSWDGVMED
SQTQESVTQFEQIEVGPLATSVEIAKHTPSREFSATETPFVSTRMTLESQTEKKTVGTPS
ELVTTGRYGFTVGEDSDEDRTLTVRSGQSTLVFSQIPEVITVSKTLEDTTHTQLEDSDLV
SASTPVSPLIMSDNNGSSTGDWGERRTNGKITEDSFGQYLSTTPFPSQYHREVELFPYSG
DKILVEGISTVIYSSPQTEMTRGRERTEMLKPEMQTVTYTDDEMQEMITKHPLMGKKEEE
GFSGTKLSMSSSEQIHFTESFVGMTESLDFPALTATKLSVEPTEVRDVDEDFTTAPDSIK
YDEYIPTVHLTHGTLNAEVVTVSKWLWDEDNATLKTSEPTEHLGSPKFPPTSLTSVGMNG
QDKELPSFTEDRGDEFTLSPASTQKQLEDITEKDLETHGKFTVRFQPTTLTGIAEESTLR
ASTSTEDRVVDATMEGSALGEREDVDISKPLSTVPQLPPTSEVGGLAFAHYSSTQEPTTY
VDSSSSIPLSVIPKREWGVSVPSVPSEDEILSEPSQDVRVIDQTHLEATVFPKAVRTRTT
QEKTQEFPWERTTEKPVTTLSSTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXTTPLGKIDHGVSYPPSAVTEHKVKTDEVGTLTPSMGPKVPLSPGPEQKYEVEGSSPIP
QSPFSTRVTQLLEETIIEKKERTPLEYTDLGSGLFEKPVATELPEFSAMTATAPSDVTAV
DRLHTTLVFKSSSAFTQKPPLIDREPGEETTSDMVIIGESTSRVPPTTLDDIVGKETESD
IDREYFTTSSIPSATQPAQPPLGEGREAFEPQSPSTLQPPKGTKLHPDINVYIIEVRENK
TXXXXXXXXXXXXXXXXXXXXXXXSEETDPEHDVIGELLPGLPEVIEIDIYHSEEDEEEE
EECANATDLTTTPSVQYINGKHLVTTVPKDSEAEEARRGQFESVAPSRNFSDMSSESDTH
HFIITETEPSAVQPNDSTENTDSLEITWKPEVYPEIAEHFSGGEPDAFPTVSSHEREVPE
GTEAGTERGSEPGHQLREHTKPIPLFPEESSGETAIDQESQKIVFSGVTEVTFGEEAENS
PSIAYAPTVGPSSVSAYFSEEESVTLARNPHPDDPLSTVESWVEITPRYTVELSGSSSIL
IPEGSGEAEEYKDNVFTVVTDLSQRNTPGTVITLDASKITTESLSEVLVTTVNSVSEQPS
AEVVPTQSISETDTPEWVFSTSLEGKIRKAEEGTTGAASTVQAYSPARKSDQSILPSEAG
SPNVVTSGNSATETSFMPLTTATNSEKEMANSAFVSTEANVLENLGVQTTEHGHSNPPGP
QEGLTGLPSSPFSLFLEQGSGEATVDLETTTVSSFSLNSESEIQASKEVAGTSPPYVETT
LSSELTTLVLSTVRDREVAEIISQTSKETLISEVLGEVHRGSEIRDSSTGFPFEEDFSGD
FREFSTASHPITKEETVMAEGSGNTAFRDIQTSPSAVPASVHILRVPPSEGPSSPMVGTA
AFPWEEFTASAEGSGEHLGPVPGSADPVPLSTVGNVPGTVLPSVDQGLGEMGVVNEVDEK
PIILPTTEAGGTEVITKKVEVNIKSTVSTDFPQTLEPAKLWSRQEVNPVTQGVASETASE
EEKMQEQKSFESTQSSLATEQTIFDSQTFTEAGLPTTDDPVLTTEKMYNPDKKTEEEGVS
LVSMPTSDSDAQDLESPTTHPEATEKAHFFLATASVTESTQAESVITDSSIKEEESTKLF
SNGMRPTIKESDTELLFSGLGSGEVLFTLPTESVSITEMEQVNSTLYPQTSQLESLETSV
LSDKTENSARMENVANEVRPLVSTTDIYEGNESVPNTTLTEILSDTGAEGPTMAPVLFST
DTKHPQSQTLRWREEIQTSRPQNITEHISNRNSPTAESEETATSSTGFLARTHGLEMAKE
LVTSSPQSNDLFREHSGEGSGELDTNDSVHISGTTQAIRQGSTTFISIQSLEKHHEVPSA
NVVTAAGFPTVSGGLPLHAEQDELSLNPTSTLSNTVSYERSTDGTTGSFQDHFREFEDST
LGPNRRKPADNIILDLDKEDKDLILTITESTILEIPPELTSDKNTIIDIDHIKPEYDILM
QTDMDSELPSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXLHILLPTATSLPLPNKSATVNPEAEEINMEV
KTLDDIYEASTLSDGQAVADQSEVVSTLGHLERTQEEYEEKKYAGPSFQPEFSSGAEEAL
VDHTPFVVTGTVRLAAGRLTEVPHGMEGSSSLYYMSTTPATSTFAKLSSQTPSLSPTVYV
GSGAFEPTEGSQPSALSIVNADSYVSPEDSFKEVYANPEVTFKPLGGEYIHITEPPALSP
DIILEPSEDETKPKLLEETTASPTELSLEEGTEVSQDFQNKINGQLSGETVKMFPSIQTP
EAGTVITAATESKLGGATQWPHSTSGTHRKEAGVVSQPSPQNSESPAIPSSLEINPETLA
VLVRGEDATAAVSEPQVAARILDPNNLATVSTMELNTELTTPPFPLLETSNETDFLIGIH
EESVEGTAVYLPGPDRCKTNPCLNGGTCYPTETSYVCTCVPGYSGDQCELDFDECHSNPC
RNGATCIDGFNTFRCLCLPSYVGALCEQDTETCDYGWHKFQGQCYKYFAHRRTWDAAERE
CRLQGAHLTSILSHEEQMFVNXXXXXXQWIGLNDKMFEHDFRWTDGSTLQYENWRPNQPD
SFFSAGEDCVVIIWHENGQWNDVPCNYHLTYTCKKGTVACGQPPVVENAKTFGKMKPRYE
INSLIRYHCKDGFIQRHLPTIRCLGNGRWAMPKITCMNPSAYQRTYSKKYFKHSSSAKDN
SINTSKHEHRWSRRWQESRR
Download sequence
Identical sequences ENSTSYP00000002932 ENSTSYP00000002932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]