SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000003182 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000003182
Domain Number 1 Region: 638-780
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-35
Family C-type lectin domain 0.000000481
Further Details:      
 
Domain Number 2 Region: 788-923
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-34
Family C-type lectin domain 0.0003
Further Details:      
 
Domain Number 3 Region: 1218-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-34
Family C-type lectin domain 0.00024
Further Details:      
 
Domain Number 4 Region: 350-467
Classification Level Classification E-value
Superfamily C-type lectin-like 2.19e-33
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 5 Region: 22-151
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.22e-33
Family Cysteine rich domain 0.00000111
Further Details:      
 
Domain Number 6 Region: 930-1037
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-30
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 7 Region: 506-638
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-30
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 8 Region: 155-211
Classification Level Classification E-value
Superfamily Kringle-like 2.31e-19
Family Fibronectin type II module 0.00065
Further Details:      
 
Domain Number 9 Region: 230-346
Classification Level Classification E-value
Superfamily C-type lectin-like 9.79e-18
Family C-type lectin domain 0.003
Further Details:      
 
Domain Number 10 Region: 1152-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000262
Family C-type lectin domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000003182   Gene: ENSTSYG00000003473   Transcript: ENSTSYT00000003475
Sequence length 1439
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_7378:3499:93524:1 gene:ENSTSYG00000003473 transcript:ENSTSYT00000003475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLPLLLVFVSVIPCAVQLLDTRQFLIYNEDHKRCVEVISPSAVQTAACNQDAESQKFRW
VSESHVMSVALKLCLGVPSKTDWVPVTLYACDSKSELQKWECKNDTLFGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSXXXXXMFTLLGNANGATCAFPFKFQNQWYA
DCTSAGRSDGWLWCGTTTDYDTDKLYGYCPLKFEGSESLWNKDPLTSISYQINSKSALTW
QQARRSCQQQEAELLSITEIHEQTYLTGLTSSLTSGLWIGLNSLSFNSGXXXXXXXXXXX
XXXXXXSPSAEPGKSCVSLNPGKNAKWENLECVQKLGYICKKGNTTLNPFVIPSESEVPT
NCPSQWWPYAGHCYKIHREEKKIQRDAKVACRKEGGDLASIHTIEEFDFIISQLGYEPND
ELWIGLNDIKIQMYFEWSDGTPVTFTKWLRGEPSHENNRQEDCVTMKGKXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXGWKRHGFYCYLIGHTLSTFSEANQTCENESAYLT
TIEDRYEQAFLTSLIGLRPEKYFWTGLSNIQNKGTFQWTIEEEVQFTHWNSDMPGRKPGC
VAMRTGIAGGLWDVLKCDEKAKFVCKHWAEGVTRPPEPTTTPEPKCPEDWGISSKTSLCF
KLFTKGKHEKKTWFESRDFCRAMGGDLASINNKDQETIWRLIMASGNYHELFWLGLTYGS
PSEGFTWSDGSPVSYENWAYGEPNNYQNVEYCGELKGDYGMSWNDINCEHLNNWICQIKK
GQTPKPEPTPAPQDNPPVTEDGWVIYKDYQYYFSKDKETMDNARACKKNFGDLVSIQSES
EKKFLWKYVNRNDAQSAYFIGLLVSLDKKFAWMDGSKVNYVSWATGEPNFANEDENCVTM
YSNSGFWNDINCGYPNAFICQRHNSSINATVMPTTLPVPSGCKEGWHFYNNKCFKIFGFV
EEERKSWQESRKACIEFGGNLASIQNDKEQAFLIYHMRDSNFNAWMGLNDVNSEHVFLWT
DGRGVHYTNWGKGYPGGRRSSLSYEDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXIALNSNLTNNEYTWTDKWRVRFTNWAADEPKLKSACVYLDLDGFWKTAP
CNESFYFLCKRSHEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSYTRNWGQASLEC
LRMGSSLVSIESTAESSFLSYRVEPLKSKTNFWIGLFKNVEGKWLWINNNPVSFVNWNTG
DPSGERNDCVALHASSGFWSNIHCSSYKGYICKRPKTDSRKMDPSKPPSSTAGVVVIVVL
VILAGTGLAAYFFYKKRRVQLPQEGAFENTLYFNSRSSPGASDMNDLMGNIEQNEHAVI
Download sequence
Identical sequences ENSTSYP00000003182 ENSTSYP00000003182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]