SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000003598 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000003598
Domain Number 1 Region: 38-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000126
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 4-39
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000157
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000003598   Gene: ENSTSYG00000003940   Transcript: ENSTSYT00000003933
Sequence length 228
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_5958:3594:24143:-1 gene:ENSTSYG00000003940 transcript:ENSTSYT00000003933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTRGGRRDRIYGTCFCDQACRLTGDCCFDYARACPVRPCFVGEWSPWSGCSDQCKPTTRV
RRRSVQQEPQNGGAPCPPLEERAGCLEYSTPQGQDCGHSFVPAFITTSAFNKERVRQAAS
PQWSTHTEDAGYCMEFKTESLTPHCALENRPLTRWMQYLREGFTVCVDCQPPAMNSVSLR
CSGDGLDSDGNQTLHWQAIGNPRCQGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences ENSTSYP00000003598 ENSTSYP00000003598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]