SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000004095 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000004095
Domain Number 1 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 2 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-22
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 273-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.59e-21
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 163-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-19
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 5 Region: 218-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 6 Region: 548-594
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-18
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 
Domain Number 7 Region: 467-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-18
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 111-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-17
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 328-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-16
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 507-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000191
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 11 Region: 372-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000572
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 12 Region: 70-105
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000228
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000004095   Gene: ENSTSYG00000004494   Transcript: ENSTSYT00000004473
Sequence length 605
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_3301:371:9292:-1 gene:ENSTSYG00000004494 transcript:ENSTSYT00000004473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TFMTFGDVIVDFTQKEWRLLNPAQRTLYREVMLENYSHLVSVEIAHSKPEFIMLLQQEEP
WEDNKRQPLGHCAEKPYFCSDCGRGCKNRSAINSHHQIHSMEKPYRGIRSKPDLIRHQRT
HSGKEPFVCRDCGRGFRVKSEVLIHQRTHSEEKPYVCRECGGFSRKSNLIRHQQMHSGEK
PYVCRKCEQGFTWKSNLIRHQITHSGEKPYVCGCRQGFSRKSGLIRHQKIHSGEKPYLCR
ECGKSFRDKFILTCHQWSHSGEKQYVCSKCGGFSRKSALVRHQRILSGEKPFVCSDCGRG
FSDKSYFLIHQRTHSGEKPYVCRECGGFSWKSSLIIHQSTHSDEKPFVCRECGRGFSQKS
SRHQKLHSVEKPFVCRDCGRGFRVKSEVLIHQRTHSGEKPYACAECREVFSRKSNLIRHQ
QMHSGEKPYVCRKCEKGFTWKSNLIRHQKTHSDKKPYICRECGRGFTKSYLLKHQRLHSG
EKPFVCTECGQDLNVKSHLLIHRRIHSEEKPYVCKECGLGCSQKSSLNRHQQMHSGEKSY
FCRCGRGFIQNSNLIKHQRTHSGEKPYVCRECGRSFSQKSNLTRHQRIHDEKPFFVGSVG
ESLPG
Download sequence
Identical sequences ENSTSYP00000004095 ENSTSYP00000004095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]