SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000006053 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000006053
Domain Number 1 Region: 181-304
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 2.48e-60
Family Dystroglycan, domain 2 0.000000287
Further Details:      
 
Domain Number 2 Region: 497-598
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 62-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000033
Family Dystroglycan, N-terminal domain 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000006053   Gene: ENSTSYG00000006610   Transcript: ENSTSYT00000006612
Sequence length 895
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_6786:2126:18765:1 gene:ENSTSYG00000006610 transcript:ENSTSYT00000006612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRMSVGLLLLLPLWGKTFLLLLSVAMAQSHWPGEPSEAVRDWENQLEASMHSVLSDLHEA
VPTVVGIPDGTAVVGRSFRVTIPADLIASSGEIIKVSAPGKKVLPLWLHWDPQSHTLEGL
PLDTDKGVHYISVSTARLGANGSHIPLSSSVFSIEVYPEDHSEPQSMRSASPDPGEVVSS
ACAADEPVTVLTVILDADLTKMTPKQRIDLLQRMRSFSEVELHNMKLVPVVNNRLFDMSA
FMAGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGAMSAQLGYPVVGWHIA
NKKPPLPKRIRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMPPPVRD
PVPGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTVTIPGYVEPTAVATPP
TATTKKPRVSTPKPATPSTDFSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRI
RTTTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKL
REQQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQ
GDRAPARFKAKLVGDPALVVNDIHKKIALVKKLAFAFGDRNCSTITLQNITRGSIVVEWT
NNTLPLEPCPKEQITGLSRRIAEDDGKPRSAFSNALEPDFKAMSVAVTGSGSCRHLQFIP
VAPPRRVPSEVPPTEVPDGCPQRCSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRK
GKLTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPSQSVPETT
PLNQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences ENSTSYP00000006053 ENSTSYP00000006053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]