SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000009589 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000009589
Domain Number 1 Region: 1113-1289
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.51e-40
Family BCR-homology GTPase activation domain (BH-domain) 0.0008
Further Details:      
 
Domain Number 2 Region: 676-791
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 9.94e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.0015
Further Details:      
 
Domain Number 3 Region: 870-1028
Classification Level Classification E-value
Superfamily PH domain-like 2.08e-23
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 
Domain Number 4 Region: 444-550
Classification Level Classification E-value
Superfamily PH domain-like 3.84e-20
Family Pleckstrin-homology domain (PH domain) 0.0000321
Further Details:      
 
Domain Number 5 Region: 1423-1559
Classification Level Classification E-value
Superfamily PH domain-like 5.91e-19
Family Pleckstrin-homology domain (PH domain) 0.032
Further Details:      
 
Domain Number 6 Region: 2-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 3.14e-16
Family SAM (sterile alpha motif) domain 0.0000385
Further Details:      
 
Domain Number 7 Region: 1007-1105
Classification Level Classification E-value
Superfamily PH domain-like 0.000000438
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Domain Number 8 Region: 619-674
Classification Level Classification E-value
Superfamily PH domain-like 0.000000881
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000009589
Domain Number - Region: 1317-1393
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.093
Family Ras-binding domain, RBD 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000009589   Gene: ENSTSYG00000010431   Transcript: ENSTSYT00000010458
Sequence length 1694
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_349:2740:174732:-1 gene:ENSTSYG00000010431 transcript:ENSTSYT00000010458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSDSEVNVDIKYFLMSINLEQYLLHFREFGFNTVKDCAAINDSVLHKIGISPTGHRRRI
LKQLQIILSKMQDIPIYANVHKTKKNDDASKDHHAPSSHQNTHVELSESGSVQTPSPLPL
ESVTKNLDGNDVSVENSQSLNTDDKWSLPEHDFPISEEPHLNLDSLRDSLFGSENVKIES
LTTKKTMNFTIEEQQTEKSNLNSDPDCLSPIGCSASGENSGNGTNGILERSPPSPFFKFQ
GEMVVNDLYVPSSPVLTPMRSRSKLVSRPTRSFLLRHRPVPDIPGSTKGISGSYFRDRRN
VAISTGKSAAWQNSNEENSSSIFPYGETFLLQRLENSKKRSIKNEFWTHEETLKGETTTG
GNSFIIKSSIYDNKKEGVSEDKVEDIWIPREDKNSTLIDPPSESEYSTVEECFQSLRRKN
SKASKSRTQKALNLDPANRHSYPLSSTSGNADSAVTSSNAISPYACFYGSSAKKVKSGWL
DKLSPQGKRMFQKRWVKFDGLSISYYKNEKEMYSKGIIPLSAISTVRVQGDNKFEVVTTQ
RTFVFRAEKEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXDFKSGLGITIIPMNVANVKQVDRTVKQSFEIITPYRFSFTAESEKEKQDW
IEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQHRSL
GPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAGNLQKDEELHMDSPVEKRKNFI
TQKYKEGKFRKTLLASLTEELNKALCAAVVKPDVLETMTLLFSGADVMCATGDPVHSTPY
LLAKKAGQSLQMEFLYHNKFSDFPQHDTHSEGGLSQESSQSTFLCDFLYQAPSAASKLSS
DKKLLEETNKKWCVLEGGFLSYYENDKSTTPNGTININEVICLAIHKEDFYLNTGPIFIF
EIYLPSERVFLFGAETSQAQRKWTEAIAKHFVPLFAENLTEADYNLIGQLFYKDCHALDQ
WRKGWFAMDKSSLHFCLQIQEIQEDRMHLRRLQELTISTMVQNGEKLDVLLLVEKGRTLY
IHGHTKLDFTVWHTAIEKAAGTDGNALQDQQLSKNDVPIIVNSCIAFVTQYGLGCKYIYQ
KNGDPLDICELLESFKKDARSFKLRAGKHQLEDVTGVLKSFLSDIDDALLTKELYPYWIS
ALDTQDDKERIKKYGAFIRSLPGVNRATLAAIIEHLYRVQKCSEINHMNAHNLALVFSSC
LFQTKGQTSEEVNVIEDLINNFVEIFEVKEDQVKQMDIENSFITKWKDTQVSQAGDLLIE
VYVEKKEPDCSIIIRISPVMEAEELTNDILAIKNIIPTKGDIWATFEVIENEELERPLHY
TENVLEQVLRWSSLAEPGSAYLVVKRFLTIDIIKQYSEKSALGSIKEGILKIKEEPSKIL
SGNKFQDRYFVLRDGFLFLYKDMKSGKHDKMFSLSSMKFYLGVKKKMKPPTSWGLTAYSE
KHHWHLCCDSSQTQMEWMASVFIAQHENDIWPPAGKERKRSITKNPKIGGLPLIPIQHEK
NATQAQRNIESARAELERLRLSEKHNKESVDSSLKEKASIVAHCLEHKDDKLRNRTRKHR
SFNCLEDTDAMTSQVQQKGSKVLKPLRKAEDRHSKATLDSDHKLPSKVIEELSVVLQRSR
TLTRELQDEQILKK
Download sequence
Identical sequences ENSTSYP00000009589 ENSTSYP00000009589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]