SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000010471 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000010471
Domain Number 1 Region: 115-243
Classification Level Classification E-value
Superfamily SH2 domain 4.27e-33
Family SH2 domain 0.0000273
Further Details:      
 
Domain Number 2 Region: 406-493
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.93e-20
Family Protein kinases, catalytic subunit 0.0000255
Further Details:      
 
Domain Number 3 Region: 71-140
Classification Level Classification E-value
Superfamily SH3-domain 1.05e-16
Family SH3-domain 0.00036
Further Details:      
 
Domain Number 4 Region: 248-305
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000307
Family Protein kinases, catalytic subunit 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000010471   Gene: ENSTSYG00000011407   Transcript: ENSTSYT00000011413
Sequence length 494
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_731:833:49766:-1 gene:ENSTSYG00000011407 transcript:ENSTSYT00000011413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSYITVQSVFCGCCGCSGQKRQVRTQVSLSKDEELSEKHTQRRRAWFSKLPIKKQSSR
VQPSTRKPLPPLPASEAAEEKIQVKALYDFLPREPCNLALKRAEEYLVLEKCDPHWWKAR
DCLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQTERLLRQEAKEGAFIVRDSRHLGS
YTISVFIRARRSTEATIKHYQIKRTDSGQWYVAERHLFQSIPELIWYHQHNAAGLLTRLR
YPVGLMGSCVPATAGFTYEKWEIDPCELAFVEEAGSGQFGVVHQGTWRAHIRVAIKAIKE
GAMSEAEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYVLDDEYISSSGAKFPIK
WSPPEVFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLHVVETISKGFRLYRPRLA
PMSIYEVMYSCWHE
Download sequence
Identical sequences ENSTSYP00000010471 ENSTSYP00000010471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]