SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTSYP00000011176 from Tarsius syrichta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTSYP00000011176
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.61e-32
Family Laminin G-like module 0.0075
Further Details:      
 
Domain Number 2 Region: 688-856
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.87e-24
Family Laminin G-like module 0.018
Further Details:      
 
Domain Number 3 Region: 911-1113
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-23
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 224-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000559
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 5 Region: 97-230
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 1297-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000407
Family EGF-type module 0.0035
Further Details:      
 
Domain Number 7 Region: 1140-1182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000482
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 8 Region: 304-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000197
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 9 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000187
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 10 Region: 70-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 378-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000455
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 12 Region: 1176-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000117
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 1215-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000153
Family EGF-type module 0.026
Further Details:      
 
Domain Number 14 Region: 1265-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000013
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTSYP00000011176
Domain Number - Region: 339-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0132
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 27-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0408
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 924-960
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0688
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTSYP00000011176   Gene: ENSTSYG00000012179   Transcript: ENSTSYT00000012180
Sequence length 1406
Comment pep:known_by_projection genescaffold:tarSyr1:GeneScaffold_3584:15234:151425:1 gene:ENSTSYG00000012179 transcript:ENSTSYT00000012180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKNINYLLIFYLSFSTLIYIKNSVCNKNDTRCLSNSCQNNSTCKGFSKDNDCHCSDTA
NNFDKDCDNVANPCFSNPCQKSATCVNTPGERSFLCKCPPGYTGTTCETTIESCGLNSCQ
HGGICLQDPVHPICICPAGFAGRFCQINHDDCASSPCHNGAVCQDGIDGYSCFCVPGYQG
KHCDLEVDECVSDPCKNGATCLNEIGRYTCMCPHDYSGVTCEMEIDECWSQPCLNGATCQ
DTLGAYICDCASGFLGDHCELNIDECASQPCLHGGLCVDGENRYSCNCTGTGFTGTHCEI
LMPLCWSKPCHNNAKCEDSVDNYTCHCWPGYTGVQCEIDINECNSNPCQSNGECVELSSE
KQHGRLAGLPSSFSYHEASGYVCICQPGFTGIHCEEDINECSSNPCQNGGICENSPGNYT
CHCPFDHLSRTFYGGRDCSEILLGCIHHQCLHNGICIPHFQDGQHSFSCLCPAGYTGSLC
EIITTLSFEGNSFLWVTSRSVAMKASFCNMALRFQTVQPMALLLFRGNRDVVLKLELLNG
NIHLSIQVNSQPKVLLDISHNTSDGQWHSVEVIFAEAVTLTLIDDSCKEKCISKAPSPFE
NDQSICAFQNSFLGGLPVGTTSSDVALLNIYNTPSTPSFIGCLQDVKIDENHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLGYQCDCHRPYKGPNCLREYAAGRFGLDD
STGYAVFTLDESYGEKFSLSMFVRTLRPSGLLLALQNSTYQYIRVWLEHGRLAMLTPSTP
KLVVKFILSDGNVHLISLKIKPNKVELYQSSQNLGSISTSKWKIQRGDAIYIGGLPDRQE
TEVNGGFFKGCIQDVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFNPCHNGG
ACYSLWDDFSCSCPVNTTGKACEEVQWCRLRPCPPRAQCQLMPQGFECIGNAVFDGQSSE
ILFRSNGNITRELTNITFGFRTRDVNVKILNAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGTWHEVTLSMTDPLAQASRWQMEVDHQTPFVTSAIATGNLNFLKDNTDI
SVGGRVIDNMKGLQGCLSTIEIGGIYLSYFENVHGFTNKPQREQFLKISTNSVVTGCLQL
NACNSNPCLHGGNCEDIYSSYHCSCPLGWSGTHCELNIDECFSNPCIHGNCSDRVAAYYC
RCEPGYTGVNCEVAIDNCQNHHCANGATCISNTNGYSCLCFGNFTGKFCRQRRLPSTVCG
NEKTNLTCYNGGNCTEFQAELKCTCWPGFTGERCEQDIDECASDPCFNGGLCQDFLNKFQ
CLCDVAFAGERCELDLAGNLISDMFTSIGSVTLALLLILLLAVVASVVASNKRATQGTYS
PSRQEKEGSRVEMWSLMPPPAMERLI
Download sequence
Identical sequences ENSTSYP00000011176 ENSTSYP00000011176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]