SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW000169-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW000169-PA
Domain Number 1 Region: 420-454
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW000169-PA
Sequence length 458
Comment hypothetical protein|DS642089:15012:36760:1|gene:ISCW000169
Sequence
MLMSRVSEQGPISSCRSSCRLPLRVAFAGKLKSEPQAILELMAANGALLTSPQDIEKECG
EYYALLYAERPVESALWDGLFDPLPRLHEGLAEGLDGPVTRKENWEAMSTLFKGKAPGPD
ASLFHTRASAQQNLLALRDMSYWVGNRKIPMLVLSVDQERHSTVSHKFLFHVLSRVGLGG
SFLSGVKRLYAAATSMVKVNGGVTQAFPIAAAFRREARRPLINKFRSLGASEWFLDLATR
VLDIPERWIQRRVSVDDRAHRLPEGSLVRRFSLKRPLDVGPAWTHWGFGGDAAKLDVDFR
VVCAQGFTGANCSDECPAPDAIGARFRCLANGSKECLEGWTEPECDVPACADGCHPEHGF
CERPGECLCKMGWEGARCERCTPMPGCLHGTCNASFECNCLPGWDGFFCNRQLKFCEDHS
PCSEGSTCVNKAEEDGFYQCLCPEKLAGRNCTVPVRRN
Download sequence
Identical sequences B7P5N2
XP_002407762.1.51680 ISCW000169-PA 6945.ISCW000169-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]