SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW000613-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW000613-PA
Domain Number 1 Region: 356-631
Classification Level Classification E-value
Superfamily NHL repeat 6.02e-46
Family NHL repeat 0.0001
Further Details:      
 
Domain Number 2 Region: 22-77
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000377
Family RING finger domain, C3HC4 0.035
Further Details:      
 
Weak hits

Sequence:  ISCW000613-PA
Domain Number - Region: 107-142
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.054
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW000613-PA
Sequence length 631
Comment nhl repeat-containing protein, putative|DS616539:248599:253513:-1|gene:ISCW000613
Sequence
MGNGNNAETPRQSITILSSKGTESLKEMVQCPICLDRLHRPKMLPCQHAFCFLCLQNSVM
KADTSKLRCAKCRTEVPLPKEGISGFPSSIHLQNILDLLESDYASMDELLQCCSCQTVSC
TVFCEHCKLSYCPLCMARHVEELAKQLGQIADQLEATVEKIGLRYQKFEASHSELQAKLK
AEAGRRVRWIRDSESQLYSRMEAAKVAEEAGYKEVVQKVQGAVISSRAFAAKGFDHIQDP
SEKIRVFMQLHQEAGDALSEGTTVGNTQITFDPDAFSVTIECRSDAVDEDTETPSSPRGS
PDCTTQSSPNASLPGSPTGALTTTPNQAEVQKQSADAQSRLYRSKSFLTRTRLGSGLVQR
PSGVAVSPWSSEIFVVSMDNHKVLTFDSTTGKFLRSFGSRGQQEGEFLCPFGIALSSVGQ
EILITDKWKHCIHVFDKDGNFQRQIGMKGRSAGHFRSPESICIDNTGRIYVCDTCNHRIQ
VLDHDGIFLHEIGTHVQPENAFNRSRSMFQEPTGIAVTQDAQRVVVCDFGSHRIHVFSTD
GEHLFTFGQKGALKGQFVHPECVAVDSRGFILVGDSGNGRVQICRPDGRHVRTFGNKGSS
NGQFSWISSIAVTANNEVVVSDFKNHSVQVF
Download sequence
Identical sequences B7P1F2
XP_002433360.1.51680 ISCW000613-PA 6945.ISCW000613-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]