SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW000831-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW000831-PA
Domain Number 1 Region: 305-624
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.47e-52
Family Protein kinases, catalytic subunit 0.000025
Further Details:      
 
Weak hits

Sequence:  ISCW000831-PA
Domain Number - Region: 192-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00335
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW000831-PA
Sequence length 662
Comment leukocyte tyrosine kinase receptor, putative|DS629199:189536:224893:-1|gene:ISCW000831
Sequence
MISRGGGGGGGGATALFKVDSRTGEMIPLVVAAGGGGHSAAAAATGDGSDVAVQGRGFQD
PQSPGNGLSAPEGKGPGGGGGWNDSSAEPNAADEPTAGRALSDGAAGGAVCADAAPWNAA
GGFGGGGGGCAGGGGGGGWKGGDAAISDHAQRSGHGGTSFVHPSRLEAASLPTACKGFGD
AMVVMVSAADAQCPCRQMCLARTLSPASFKCACPRGFRLARDGLSCFGKCNQSYCRSRGR
KAGYSAPPIFHARVFTGSLNSHPEPLGNNPEVQLSRLRQATGMVTEYNPNYEFGGSTCTL
QDLNDIPRENLTLVKALGQGAFGEVYQGFLLPAAVPTSPTSPVSEGAPPLASAAADVPVA
VKTLPELSSPESEKDFVTEACIMSKFNHPNIVRFIGVCFEKMPRFIVLELLAGGDLKSFL
RESRPKPSIPPSLTMTDLLNLAIDVAKGCQYLEDKHFIHRDIAARNCLLTTKGPGRVVKI
ADFGMARDIYRAGQRRTAPKTYSAVCRCPDTKRHVKGMCNGAYDSGDLLPFEKSMFNDGW
EAKNGSRAFPSQVTSGGRLEPPANCPGPVYHVMTQCWHATPEERPTFGTILERLGYCLQD
PDVTSAPLPVFHRPPSRERDTTVMRPPNPDNVCLQVGRPPLTEERRNSPPRAVGTSQADV
TR
Download sequence
Identical sequences B7P3J2
XP_002404312.1.51680 ISCW000831-PA 6945.ISCW000831-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]