SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001053-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001053-PA
Domain Number 1 Region: 314-588
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.81e-54
Family Protein kinases, catalytic subunit 0.00000702
Further Details:      
 
Domain Number 2 Region: 24-115
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000507
Family Fibronectin type III 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW001053-PA
Sequence length 611
Comment activated met oncogene, putative|DS636620:44425:73231:1|gene:ISCW001053
Sequence
MPLGTQVRAVPLKNYAPHLGGPLEWKYTDASRAELFGLSAGTLYNVSVWAETSDGPSETT
SIFAWTQVGEPDRPPPVEVLSRDGPRMVVRVARGTSTKGPITGYRLIAFEESSLMSFKPE
RLVGHKEASEAGTPFYLAAELGPDHGGREFVLGAGSSHGGFFNAPLLPGEKYLPIQGVAS
TLNGITKYAYSVMAPDASAGGAEEQVMTGEPPRGPPTRAALVSLLSVAVGVCTFLLAAFV
VAYLLLRRHYGKKKRRSEEMILQCHPPPDPETEDGPFCAGALQLGEGADLGAFYGQLRAM
FWQVPRPQLLVRDTTLGQGRFGPVRAGVVHRDGSDLSVGVQRCSAQWMLPDRERRQLLAE
IEGMVRLGVHPNVVLFIGACEDQEFLQLVVEHPPRSLRGLLLTSRHSSEGRVCSLEERQL
LELAKGVAAGMTHLARHGVHHGQLSTRSITVVDDLVPKISNFGLARYTPLGKVGIYFGSN
QRLLYRKLDFARWLAPESVKTGSHTAKSDVWSYGVLLWEVFTLGGTPYVNLKTAEVAERV
TRGLRLSQPKGVRENMYQLMLQCWELDRDERPTFEQLLGSLQEMLCGEIPVKFSHTPGYT
YERFDPLADET
Download sequence
Identical sequences B7P4P0
ISCW001053-PA XP_002406319.1.51680 6945.ISCW001053-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]