SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001411-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001411-PA
Domain Number 1 Region: 5-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000145
Family EGF-type module 0.047
Further Details:      
 
Weak hits

Sequence:  ISCW001411-PA
Domain Number - Region: 116-216
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.0105
Family Atu1540-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW001411-PA
Sequence length 377
Comment beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyl-transferase, putative|DS627105:222579:230029:-1|gene:ISCW001411
Sequence
MPNANGGSCFTYGTNSSVSNNSCVCLQGWNGDTCSVPQVLWMDRGVRRWYAQGIIKRRPR
PRMIINLFMFNHEIDMLDIRIHVLGDAVDYYVVCESNYTFFGSPKQLYLSSNLSAGFLSE
HRHKIVLLRSGFNYAIDKDHWAPENNLRSLLWKEGRHRFQNLRDDDLLMLNDADEIPSRE
LMLFLKYHDGYREPIVLYLRWFFYGFFWENYLPSVVPSICTVAYLREVYGDDSNLNDRPV
IVTSVCTVGYLRDVYGDDSNLVRRNQPFRVIQPTRTSTGTVWNPWTIKGVSPKYAGWHCS
WCFSISGIQIKLASSQRDDGIRWADFAEKHDPEYIRFLRREGRFFDESPPLRKADGYRAA
PAYVVQEEKRWPYLLDV
Download sequence
Identical sequences B7P3A0
6945.ISCW001411-PA XP_002403751.1.51680 ISCW001411-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]