SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001427-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001427-PA
Domain Number 1 Region: 184-330
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.7e-23
Family SPRY domain 0.013
Further Details:      
 
Domain Number 2 Region: 16-54
Classification Level Classification E-value
Superfamily SAP domain 0.000000000256
Family SAP domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW001427-PA
Sequence length 368
Comment E1b-55kD-associated protein, putative|DS625912:2559:22374:1|gene:ISCW001427
Sequence
VVPLGDPSPLPKMSDVDISKLKVVELKAELQARGLDTKGNKAVLVKRLKDAMDAGPTGEG
PDLLILLLYAGSADARPAAPPSVKEEPAEAEVHSNNNNNTEEDEGACPAAAEAPPPQADA
EMVQVKEEPMEVATAQVNGEQQDQAAVKTEQGAGDAPTQDNSDLNLSIGKERFSAEPFSQ
LGFGLMWAGARATYGVLKGKVCYETKITKYQDVSHLPSDEPTPNVARVGFSTESTSMQLG
EEPLSYGYGGTGKISVDCKFKDYGEPFGEGDVILGLVDMDSDPVRMSFAKNGKDLGVAFE
VAKATLGGQALFPHVLSKNCSFEVNFGQKEAPWFPLPKAYQDYSFLGCVPLDERLRGVLG
PKKKADCE
Download sequence
Identical sequences B7P318
XP_002403423.1.51680 6945.ISCW001427-PA ISCW001427-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]