SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001458-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001458-PA
Domain Number 1 Region: 68-181
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000895
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 2 Region: 204-314,346-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000373
Family Fibronectin type III 0.007
Further Details:      
 
Weak hits

Sequence:  ISCW001458-PA
Domain Number - Region: 5-56
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000267
Family Fibronectin type III 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW001458-PA
Sequence length 999
Comment cell adhesion molecule, putative|DS646122:38681:56766:-1|gene:ISCW001458
Sequence
MHILNKTSLMVQGLTPYTNYTFRLRARASRAVMAELWTESVFLVQETLSDVPDSPPRISE
SGFKVQNYQSKRSITLNFETVPRKHWCGAMLKYLVECCEENPLEDRCENKTSQVPTVTFE
NLLRNAAYKFRLWSLNENGLSRVHSSMRVDRHDDLMNAPQDIKVMALSSGEYEVSWRPPA
TGRVLSSSSPALSSGFEEAEAPSPGYTVFWCPRMLPRSYSCNQSLEWRRLPPNVTATLLQ
LEPDKVYQFAVAAHGASNASEMAWTSCVIPVSKELEKITQVSLERDGPHSLLMRWQLECS
ALKSFVDGYQIEACAVADKYRNMALHDAAGCQYSRYDPQSCKVYNVTNADAEERLLDGLD
TNSVYRAVVRALSNGRLTDDSPVQCARTESVGPAISLVIGVAVGGALGLTVLVLVLYLLA
RWMKKKVDMIKEIKIQLPDGLDSANANQMHSYKNMRNGSAHRGTDANPSPHIPYGRMGCF
SAADHAPKKRHDSGHSQGSSSSTDELLYKKTRRTDTPGRNPSGTAAGQHQRPRQPRLSRH
GTHLLPVRLRRRERPGRTPSPDCVLPTHNTTPRCRPNLPKLDEDKDRESQDSGLDTAGNA
PRALPSVPNDGPSQEPYSKLAVCAAVAETPGLQSQLLASSEPSLLDIPGGSPQRVRTPSA
PYSKFGLARSSDEVMLPGPYSVCRSPPPPSAARRREGGPPAMPYSQLALRGGVPPFLGTG
GRDLTVGMMLEQPRVLPHIKDISAPVRAAMPPSGYVTVGQAMKVHPADSSSAGPGYSKLG
IQPPTKTPPTDSGYVPLHHMVGAPNGCGPYVPPYEGVRPDASYDGESSSDDVAIGAGENS
NDASLEDFSFSSTSPPGEPADCLLSGEGRPFPLQTLSPVRAAPGLGYVSAAAVLKCPFDE
PSGGNSASTNGYAPAQSAARGPQPADDYVSHNAAIGWGRSASGDSADGSDGSPHPSDGAT
NGYVSLPVAMDVASPRSVTVGYVPGVKTGSSSARVDCSV
Download sequence
Identical sequences B7P6I6
6945.ISCW001458-PA ISCW001458-PA XP_002408842.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]