SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001530-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001530-PA
Domain Number 1 Region: 2-149,300-379
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.22e-52
Family Protein prenylyltransferase 0.00000454
Further Details:      
 
Domain Number 2 Region: 389-509
Classification Level Classification E-value
Superfamily L domain-like 1.04e-19
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW001530-PA
Sequence length 514
Comment RAB geranylgeranyl transferase alpha subunit, putative|DS617959:5689:14653:-1|gene:ISCW001530
Sequence
LLRITGQVLQTNPDDSTLWNIRREVFEKYFEKGQVVYTICLLPHCELMLTEMALQKNPKS
YGAWSHRAWAMAAFPNMDWDRELRLCNLLLEQDERNFNGWDYRRLVCQHAKVTPEKELSF
TMDKIAANFSNYSAWHYRSSLLPKVHPGCQEGTVEEDLDIMQVDCVIIQLSLLISERPAL
GFLLFCVSKETRTLFCVLHNFLENTFYNPIFSHVLLYRFSALTVRMDGVPLSLVWHAPST
LLCSPLWYADIPGDALVGDCDNEWKATVRSRDGAEAHAVLSVKASEQEVRFTGNIPRNHL
FSCELSAARTSVLEKELEVCQALHELEPQNKWPLLTCVLLMRALDGSGHREEIEKFLVEL
LTVDPMRSAYYRDLKSKFVMEIALEGLDANVERVSFAGKELTCVYHADHLALVRDVDFSR
NRIRSLRSLCFLQSVVRLDLSGNRVLTCLGLEELPHLQWLSLEDNEISSLDGLVPLKTCR
KLTTLLLKGNPVCGYEKDLPSFLPRVKIFCNSSA
Download sequence
Identical sequences B7P1S2
ISCW001530-PA 6945.ISCW001530-PA XP_002433480.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]