SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001673-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001673-PA
Domain Number 1 Region: 1041-1241
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-36
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 855-1042
Classification Level Classification E-value
Superfamily Fibronectin type III 5.16e-27
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 3 Region: 728-837
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 629-736
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 454-548
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.054
Further Details:      
 
Domain Number 6 Region: 356-454
Classification Level Classification E-value
Superfamily Immunoglobulin 7.36e-18
Family I set domains 0.02
Further Details:      
 
Domain Number 7 Region: 559-646
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000204
Family I set domains 0.02
Further Details:      
 
Domain Number 8 Region: 269-350
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000461
Family I set domains 0.0064
Further Details:      
 
Domain Number 9 Region: 208-275
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000792
Family I set domains 0.029
Further Details:      
 
Domain Number 10 Region: 1264-1331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000166
Family I set domains 0.048
Further Details:      
 
Weak hits

Sequence:  ISCW001673-PA
Domain Number - Region: 18-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0185
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW001673-PA
Sequence length 1335
Comment cell adhesion molecule, putative|DS632703:18196:118753:-1|gene:ISCW001673
Sequence
MHGQGSIGDPLADVVGVRRLLPNGTLVLEPFSAQKARFHSGVFQCVASNEVGTIVSRDVH
LRGESVSESQLHVLTTRVCFNLGVRVGFRVNMLVLKANSRRSLSVHPLAATPKAVGGWAR
YSVLSPTGELLVRNVSSSDDGISYRCQTRHRLTGKAKISDTAGRVIVNRESLPWRNGTST
RSLSFLIRLAQSIELVALFSGTHCHCLTSKRRWYKLSGGTNESREPLHQGGRFSVSGGTL
SIRHAAVADSGRYLCVANNSLASEPFTVTLTVMAPLSAVVVPDEQTVDLGGSATFSCVPS
GHPVTSLVWLKDGRTLRQGDPRIQVPLEDSGMYQCLVKNDQDSAQGAARLKLGFSAPTFL
SVFSEQSAEPGRGVSLQCSATGSPVPRITWSLDGTSLAADPRVRSGDRVAAPNHVTSFVN
ISAARTEDGGLYACAASNGAGSVEHAARLNVAGPLRVRPMVPVRAVAGGPLRLDCHYAGH
PVDRISWTRGGVHLPSSKRQEVLRNGSLVISEVRQYEDNGTYTCHVSGPLGQSTSGTVTV
NVRVRPTIAPFSFPGGLQAGMRARLGCTVISGDPPFEFDWRKDGRPLSPELGVRAQTDAF
SSDLTFASLGPRHNGNYSCVVSNAAASASHSASLVVQVRPLWVIEPGDASVLLGRDARMD
CRADGYPVPTITWERENLYGSSGYSVITSGSDYEIFANGSLLVKNTREQSAGRYLCQATN
GIGSGLSKLVHLKVHVGPNFDIKFRSEAVQRGGPARLRCEAQGDPPVTLTWAKDGQSLGP
PATDQRYTFREDPTSSPRRAISILEISSVERRDAALFTCRASNAYGGDDLNIKLIVQGLV
TQGRGAKPLSMKTTLLWSGELETDSKATSFHFSFNSKTLQRPSANMSVGGGNVWAAVRPL
RPAVAYRCQVRAENEVGIGEPSEAAQVTTGIEVPGGPPLEVKATAVDSQTVRVTWKPPER
DLWHGELKGYYVGYRLDQRGDPYLYKTLQLGSGQEGPHIPEEVLLSPLRKFSPYVVLVQA
FNAAGPGPRSDEVSVSTMDDVPSQAPQEVQCAALSSESIRVTWQPPPKDAIHGYLQGYRI
WYAQLPASRGEWGCREEKAVTGQETTLVDLRKYANYFIQVAAFTQRGLGTESEPVFCRTL
EDVPDSPEDVKVLIVSATSLLVAWKPPVHRNGLITMYSIYAKTLDKRVRTELPFIPLLLS
HTPLEYNLTLVPRNARVEVWVTASSRVGEGPPSKIVAQTTSDQGERQLRFAATGSCSSRV
TPTFFFFCVVLLAIFFFNVRTVLSKSDRTELGADGSLALRRIEAADAGNYTCNVRNKLAT
DRRHVALIVRGQHRP
Download sequence
Identical sequences B7P416
6945.ISCW001673-PA ISCW001673-PA XP_002405078.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]