SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001714-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001714-PA
Domain Number 1 Region: 49-139
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000129
Family Fibronectin type III 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW001714-PA
Sequence length 176
Comment hypothetical protein|DS615890:3520:45425:-1|gene:ISCW001714
Sequence
VVAGSLAMASFLPSKRRDFDLSFDRFKYNKQRESNHRAFRLSFAQTGTVTALSPVTVTSN
SVVLSWNQPSTQVDGYEVRLSRGSSLVFVSRFELSAADKNRTTLFYGLESLMPGVTYNFS
VAAIAGSQTGSFVSVLFTTPRAVYVVTDGCHTSRHPGYSIADSKHAYNPNGFKHYR
Download sequence
Identical sequences B7P1B5
ISCW001714-PA XP_002433323.1.51680 6945.ISCW001714-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]