SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001732-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001732-PA
Domain Number 1 Region: 601-806
Classification Level Classification E-value
Superfamily Fibronectin type III 2.97e-45
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 804-986
Classification Level Classification E-value
Superfamily Fibronectin type III 9.63e-30
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 505-607
Classification Level Classification E-value
Superfamily Immunoglobulin 8.7e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 406-508
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-20
Family I set domains 0.054
Further Details:      
 
Domain Number 5 Region: 309-412
Classification Level Classification E-value
Superfamily Immunoglobulin 6.83e-16
Family I set domains 0.033
Further Details:      
 
Domain Number 6 Region: 222-313
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000102
Family I set domains 0.024
Further Details:      
 
Weak hits

Sequence:  ISCW001732-PA
Domain Number - Region: 87-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0788
Family I set domains 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW001732-PA
Sequence length 1154
Comment cell adhesion molecule, putative|DS634467:92893:194770:-1|gene:ISCW001732
Sequence
MRTIISNPPRLRQAIPGPPLAFSQPCRLSSPTDSSECVRTGCVGPCRTSRARGWGRRVRR
SLLPDAESFGDSSGQATASSASEEFAYPPVKSVRVRDVSSVTALKGKSVSLVCPLYVAAW
ASVSWEKGTISSNPPRLRQAIPGPPFAFSQPCRLSSPTDSSECVRTGCVGPCRTSRARGW
GRRVRRSLLPDAESFGDSSGQATASSASEEFAYPPVKSVRVRDVSSVTALKGKSVSLVCP
LYVAAWASVSWEKGSSKIPFNHRQRVQPDGSLSISNVQQVSDDGSYVCRFTDSRNQKHTG
NVLLKVIEPPVISHYEFRQDMQVGMRIKVFCTVVRGDAPFLFTWLKDGVPVDPAAGVQAG
LSVQNQRDYSMLSADSLQLEHSGNYTCVVKNQAATTTYSAMLRVNEPPKWEVEPENAAVV
QGRNVQLQCSANGTPQPTITWMIASDSTREEFLPLYNSHKYGLFPNGTLSIHQLEPEESG
YYLCKASNGFGEDLSKLVFLTVKRPPKFDVKFRAHAVKRGEKAKLACTATGDLPIAVSWS
KNNDRVPDKSKVSTVANQSVSSVTSTLVVSTETVEDSGIYSCMAKNHYGSDETSMRLLVQ
EVPGAPVNVTVANATGNSLLLSWAEPFRGNSAITRYLVQFREAGSDDEAALRNLTTNTSL
TLASIGSLRPARVFSLRVKAENGVGWGRFSGWVTANTEEDSPASPPVNITARPTGPNSIK
ISWEPPKEEDWNGHLKGYYISYRPVGSSDQYYHKTVDVHNPHQRQEIHLTNLRLSMSYSV
TIQAFTSKGAGPMSQEVLVKTLDDVPPSPPTLEVVSVTTSSVTLGWSLKTSFGNPVTEYV
LHQRKDSDHWQETPISTVQPLHTVRDLECGTTYQFYMTAHNSLGRSEPSDVIRAKTDGAA
PLSPSKEEFIQAAQRHATLSLRSWKSGGCELLDFSVRLRQGGPPQAWANLAEGLPANQSQ
FLLRNLTPGATYHVHVVAKSTAGATEAQYEFATLNGTTHVASVEATSTQPKRSTLPSMTD
LEIIVPILVSSFVVLVVIIVGCILCSRESLCAERDNCARPELRSNYSEEVVAMKELANAA
ECMARCEDGMHAPQMGSPFPTAQSIYAQRPGKSLTRTKPRERPYESLMVNMNPYPADGTT
TSTLSRKEHEDVQV
Download sequence
Identical sequences B7P4A1
6945.ISCW001732-PA ISCW001732-PA XP_002405684.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]