SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW001834-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW001834-PA
Domain Number 1 Region: 26-160
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.39e-31
Family Calnexin/calreticulin 0.0000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW001834-PA
Sequence length 169
Comment calnexin, putative|DS683640:369034:369656:-1|gene:ISCW001834
Sequence
MDFDLVLPLLSPGVLCGGKEAKEPKEASKDGAEGSVEKYGGKWQVDAAVRNHRRGDLCLV
LKTKARHHTIAAKLKKPYLFEHKPFMLQYEVQFLEEQNCGGAYVKLLCDMKDNGDLGLFD
DNFPYTFMFGPDKCGRGHKLHLIFPHGNPRNKSYEEKHWEKSGDVSKLN
Download sequence
Identical sequences B7PCE9
6945.ISCW001834-PA XP_002409759.1.51680 ISCW001834-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]