SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW002084-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW002084-PA
Domain Number 1 Region: 281-366
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.0066
Further Details:      
 
Domain Number 2 Region: 363-460
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000141
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 3 Region: 118-196
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family I set domains 0.038
Further Details:      
 
Domain Number 4 Region: 34-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000329
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 211-277
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000587
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW002084-PA
Sequence length 493
Comment hypothetical protein|DS682176:7323:33608:-1|gene:ISCW002084
Sequence
MRRHDAIVEGEENLPVERKYLSECRGELFLQPAKPELSLFTGENFFVTCFAGPGTEQQSI
TWTGPDGKEIKTTYGRIHIVPPTGDQSGLNLVVEEVWASDKGSYTCSSPNQGEEATFNLV
VYRAITFEGTPDKQSGSEGEDFLLKCNAQAESKPFVSWNRDSKTIKNSKKYKIEDQALLI
RNLSRHDAGNYTCNAYLATALLSAVKYKVITLSVHYGPEWKPPIQEAAYARLGSTAIFNC
DASGMPEPTILLFSDGQMIESDDEHDINGDVGSSTLREAAYARLGSTAIFNCDASGMPEP
TILWFRDGQMIESDDEHDINGDVGSSTLRINVTDISEFGEYTCRVHNELGVQEHVILLKE
GEAPKAPRVAVVESNPSALVLKIEHPAKEPLKVVSFRVEYKTDKDPSWDTAASQEYETGN
GLQYTLKNLNHDTSYAIRVAARNAAGYGDFSDEIYHRTKDPQHYTQANGGYGFWGSQSIP
ALLSLSCILLLRL
Download sequence
Identical sequences B7PC65
ISCW002084-PA 6945.ISCW002084-PA XP_002409462.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]