SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW002520-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW002520-PA
Domain Number 1 Region: 81-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000645
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW002520-PA
Sequence length 165
Comment protein spitz, putative|DS662727:7614:11530:-1|gene:ISCW002520
Sequence
LRGTLSFILLPCVLGIVSCIVFGAKIECSLIPGVCSLVSDMDFSCLADGCSSRSTPKPRA
PQSTVRPNITFQTYTCPEAYAKWYCLNGATCFAIKIGESILYNCECADGYMGQRCEFKDL
DGTYLPTRQRVLIEKAGLAGGVTLAVLLVFLIVVFVYLYYRWVPR
Download sequence
Identical sequences B7P9D6
XP_002404020.1.51680 6945.ISCW002520-PA ISCW002520-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]