SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW003285-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW003285-PA
Domain Number 1 Region: 21-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000439
Family Growth factor receptor domain 0.0043
Further Details:      
 
Domain Number 2 Region: 94-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000291
Family Ovomucoid domain III-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW003285-PA
Sequence length 174
Comment Kazal-type serine protease inhibitor domain containing protein|DS676624:12810:19981:1|gene:ISCW003285
Sequence
MKRVLLFVLFGALAALAARDECGPCDPDACRTPDSCLAGLVKDACGCCMVCGQREGHRCY
HRSVAGSWEHGPCGEDLDCRPRADLAPGDPAEALCVCNKAWPMCGSDGVTYDSVCQLTEA
RYSRRDGLEAASRGPCMAVGKTRRSSGDSESLTSDAEVDPSQARPPTRSAVQSG
Download sequence
Identical sequences B7PBJ8
XP_002408307.1.51680 6945.ISCW003285-PA ISCW003285-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]