SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW003447-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW003447-PA
Domain Number 1 Region: 97-189
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000244
Family I set domains 0.037
Further Details:      
 
Domain Number 2 Region: 5-104
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000337
Family I set domains 0.025
Further Details:      
 
Domain Number 3 Region: 200-282
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000543
Family I set domains 0.027
Further Details:      
 
Weak hits

Sequence:  ISCW003447-PA
Domain Number - Region: 277-365
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00156
Family Fibronectin type III 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW003447-PA
Sequence length 393
Comment sidestep protein, putative|DS729966:6475:32770:1|gene:ISCW003447
Sequence
MYVKPSTVRIRSKQRPLVAGLAAEIECEAAGSRPPPVISWWRGKAKLPSNHFKVLLIGNR
VFSVVAYTPTREDNGKRLRCVAENPNIIGSSIEASYNLDVHYKPLVTLQLGKRLRLEEIF
EGQDLYLECSIDANPHVSEVVWKFEGREVHSDPAAKVITSNQSLVFQSIQRHNAGRYTCV
AINSEGESVSNERTVYPAAAHEMVQVSCDVDAHPFVTSFRWAFNGSLRSHEVQSFVSEGG
RSVASYVPREEADYGSLFCWAVNEIGTQKTPCQFQVTPVGPPLAPSNCTLTNQTEVAFLA
ECREDHIGGPRQLYSLEVHDVSCHRLLANLTADRPAFWVQGVPAGINVVLVLYAANQMGR
SQPVLLRAEAADRHWEGLRHGKYFKPSVKTSFD
Download sequence
Identical sequences B7PK17
6945.ISCW003447-PA XP_002409140.1.51680 ISCW003447-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]