SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW003491-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW003491-PA
Domain Number 1 Region: 764-956
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-33
Family Fibronectin type III 0.0008
Further Details:      
 
Domain Number 2 Region: 586-766
Classification Level Classification E-value
Superfamily Fibronectin type III 5.37e-31
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 1236-1402
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-29
Family Fibronectin type III 0.0005
Further Details:      
 
Domain Number 4 Region: 1400-1545
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-24
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 5 Region: 1098-1248
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-22
Family Fibronectin type III 0.00035
Further Details:      
 
Domain Number 6 Region: 944-1056
Classification Level Classification E-value
Superfamily Fibronectin type III 2.33e-20
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 7 Region: 396-491
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-19
Family I set domains 0.0041
Further Details:      
 
Domain Number 8 Region: 299-397
Classification Level Classification E-value
Superfamily Immunoglobulin 3.88e-19
Family I set domains 0.0024
Further Details:      
 
Domain Number 9 Region: 489-578
Classification Level Classification E-value
Superfamily Immunoglobulin 5.66e-19
Family I set domains 0.049
Further Details:      
 
Domain Number 10 Region: 22-108
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000425
Family I set domains 0.0094
Further Details:      
 
Domain Number 11 Region: 181-287
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000033
Family C1 set domains (antibody constant domain-like) 0.094
Further Details:      
 
Domain Number 12 Region: 120-195
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000401
Family I set domains 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW003491-PA
Sequence length 1754
Comment sdk-P1, putative|DS694733:65649:126877:1|gene:ISCW003491
Sequence
MHSHILRSNRIQPRDFVEHQWAPRFVKHPEGGYVSLGQRRGLHCDAVGSPAPRLRLLRDG
QPLTNWTGTTRLLHVLSHVELSHAGLYQCVANNSAGSVLSRTAKLRVAHLTASEPVSKTV
TVQVRRGSPVVLDPPRAESVPAATATWMRLSGDASGSEPLEGIQYATTQDNHLVILEARF
EDQGRYQVELTNPHTGEFLLGPLLELEVEGESVEEDGPHKLSIVVPPSESEFNNLGNGYD
NTLECIAAGSPLEEVRVSWLKGGQPLRGLPHALTHWNRTLTLLNRLSEGPNYGGSLLWVA
VPPRLVQAVSEETAAELGQHLQLPCLAEGRPPPAVEWLRNARPLDVAAGGRLHVLSNGSL
DIDALSMEDAGVLQCVAHNPLGEARAATWLHVKISPPAFLRPPENVTVLDGMDAQLPCAV
VGAPLPNTSWAYNDLHPVLNEGRTQILDSGTLVIASVVTGDSGKYSCTRANSAGATQAEA
YLTVLVRTQIVKPPVDTRVILGSTAELQCRISHDPSVPYEVCWFFGEQQLGALSRVRLSP
DGTLRIDQARNTDIGTYTCMVTSPGGNDTRSARLEVIVAAPLEGERNGRLLGYAVEYRLA
GYPSSPWAGVNVTATRATLEDLIVWQTYALRVAAFNEKGLGVFSEPIHVRTREGVPQAAP
SGLRADALNSTAVQVRWRPPDPQLVNGLNQGYRVEAWPRGSAVGVGSPEASLVVAPLGGA
PLQEHAAVVAGLRKYHSYNLTVLCFTSPGNGPRSAPVLVTTKQDVPGPVGSLKFDDILDV
SVKVLWTPPEDTNGILLGREGWSGGGKTSAPDARTLSVSPLVPFTEYRLRLLATNVVGPS
PPSEPSQWFQTIQAPPAHPPRNVTVRAVNAHALRVRWTPLPQVDWYGVPRGYNVSFRTSD
EGDFRWTVVEDHNANSLVLDDLQAFTPYEVFMQAFNDVGTSGPSDTSKERTREAVPSAGP
SQVSAKATSSTTVVVTWGPVPRAHRGGILEGYRVVYRAAKEAEPTRKHIESNATFTTTLT
ELRKHTSYTVQVLALTRVGDGALSLPPVTVTTFEDVLTPLCLLSQPQSYYAFAVSARTKE
GWGLEARALVLTTASREKPQAPSRPLVSPSQVQARHLTLSWTPGRDGFAPLRCYLLQKIE
AGGPWKELPQKIDPGATTYTVADLRPATRYLFRLRAVNDLGFSPWSEESNETWTLPAAPE
VAPTGVVVTPYTTTSITVVWKGIAEEAWNGDLAHPSYRVEACPVGAGPQECRSRSLEGAG
GGPLTLEGLQRDRIYEVRVVATNGQGDGPTSRPVSVYVGEAVPTGYPRQVRLDAPSPTEV
AVSWAPPPEDERNGELLGYKIFYKAEGDAEEAMEAVPATPAAYTLTDLRRFTRYSVQLLA
FNPAGDGPRSQALQVQTLADRPGVPGPLDFSDITMNSLNVSWSPPEEPNGVITGYLVNYE
TADLDIESGRQVRQKVSHTFLAVRALCEMTTYRFSVQAETSQGYGPESQRNVTTGPQEGS
PLAPLELALQRNAGGATLSWKEGPQGSAPITGYLLEARPSHSGKLFLEYKQRMPFYREPW
FLVVLAAGSMVAIILVVAVLCVKSKTHRYKQEMQQSLQSEDHLSLEDAGFGSPEPSVGAK
RSLTRASLRKPLRSPPRPSPASVTYSDEDDTKGYDDHCDSSSLTEKPSEMSSSDSQGSES
ESDTKGDPHSFVNHYANVNDTLRQSWKRQRVAKPPSYTDSEQDSATAMCLNGGRVVLHNM
AGSRAPLPGFSSFV
Download sequence
Identical sequences B7PEB1
ISCW003491-PA 6945.ISCW003491-PA XP_002400783.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]