SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW003709-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW003709-PA
Domain Number 1 Region: 40-247
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.8e-57
Family Calnexin/calreticulin 0.000000636
Further Details:      
 
Domain Number 2 Region: 249-387
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.05e-54
Family P-domain of calnexin/calreticulin 0.000000579
Further Details:      
 
Domain Number 3 Region: 389-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000728
Family Calnexin/calreticulin 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW003709-PA
Sequence length 560
Comment calnexin, putative|DS709197:64944:81564:-1|gene:ISCW003709
Sequence
MHFCLVLLLLVPGALCEGEEEKVSKVEPAEDVVYNVPKPVGFAHIAEHFDDLDAFKERWV
LSEATKDGAESSVAKYDGKWQVEAAARNHLRGDLGLVLKVSARHHAIAAKLDRPYLFEHK
PFVLQYEVQFQEGQDCGGAYIKLLSDLEENRDLRQFHDKSPYTIMFGPDKCGTDHKLHLI
FRHRNPRNGSYEEKHWKKSGGITKFDEVFKDKRPHLFTLVLTPDNHFEVLVDQRSEAKGS
LLEDFEPAVNPPAEVEDPTDVRPADWDEREKVPDATATKPEDWDEEAPRQIPDPDATKPV
GWLDDEPALVPDAAAERPKDWDDDMDGEWEPPLVNNPKCTAVGCGEWKPPLVDNPRYKGK
WRAPLVDNPNYKGKWRPRKIPNPHFYEDSHPFRMTPVSAVGFELWSMSEGILFDNVLITD
DPVVADQWAADTWLLKKEAGDRETDGLLTRLLKYTNKYPWLWAVYVVALGLPLVLIVGFC
CSSSQDKKAQHKKSDDVPAEEEEEPREEAPAPIEEEEEEEEGAGGEASASNEEGSGDGED
VDGGAGDAKRSPRRRRPRRE
Download sequence
Identical sequences B7PGQ2
6945.ISCW003709-PA XP_002401232.1.51680 ISCW003709-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]