SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004309-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004309-PA
Domain Number 1 Region: 4-128
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.66e-27
Family ABC transporter ATPase domain-like 0.00023
Further Details:      
 
Domain Number 2 Region: 503-598
Classification Level Classification E-value
Superfamily E set domains 0.000000000000399
Family Filamin repeat (rod domain) 0.0078
Further Details:      
 
Domain Number 3 Region: 542-713
Classification Level Classification E-value
Superfamily NHL repeat 0.00000000118
Family NHL repeat 0.017
Further Details:      
 
Domain Number 4 Region: 234-285
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000032
Family B-box zinc-binding domain 0.0045
Further Details:      
 
Domain Number 5 Region: 153-225
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000581
Family RING finger domain, C3HC4 0.0064
Further Details:      
 
Weak hits

Sequence:  ISCW004309-PA
Domain Number - Region: 314-346
Classification Level Classification E-value
Superfamily RING/U-box 0.0263
Family RING finger domain, C3HC4 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW004309-PA
Sequence length 714
Comment RING finger-containing protein, putative|DS705266:72827:95810:-1|gene:ISCW004309
Sequence
MSCSLDGLDVRAVNVGYLRQHVVASSSQLGLLERSIWDNITYGLDVATSPVSFQQVEQAA
KVAQVHDFVTQLPLGYDTPLGGTAMTHLSEGQKQRIALARALLREPAVLILDEATTALDA
EHEQEQLQLAARCCYGSHGSRLRSLTGFGNGTCLCTYDGGERSPKLLSCSHTVCRSCLER
LAVATGAREGGCLRCPICREAVPLPEPGVGALPPSFLVNQLLDLVASRRREVVPKCATHP
GAPELLFCESCDQAFCGVCLGDAHADSRHTVVPFSIAVKRMSEILLYKGPEAGGTMTAST
LVETVSLNYEDFSESFLTCSTCLCTYDGGERSPKLLSCSHTAQLCLNKLDAAVEAVGTEI
AQLDQSAEEVTDQVEASFREVQDLLEQRRKTLLAALQALWDGKKGLLQEQLDLIQAERSQ
LERECGATDGQLEVRNLTKKISDLDSKMGSLGLLAEPRENSYLRYDYGHNGALEDVSRAL
GVFGRLQTSRTFPPLCTLAVADCPAHLEASAVLRTFDYEGRPRTTGGDPVTVELTESEGE
KKQLDVRLTDLGNGEYVLAFRPPRVGRYSLAAAVLGRSLQGSPFEFAATNGVDPDVVFGR
RGSGDDCFLQPVAAVYGPGGLVYVLDTGNCRIKGRGKGRFSGLCFDSEGRVLAARSDRSK
NSVLLFDAVGGALAFTIESRSGRLGRPGGVAALPGSRAAVVDLGNNCVKKYRYQ
Download sequence
Identical sequences B7PG11
XP_002434133.1.51680 ISCW004309-PA 6945.ISCW004309-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]