SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004405-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004405-PA
Domain Number 1 Region: 50-269
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000038
Family Laminin G-like module 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW004405-PA
Sequence length 476
Comment hypothetical protein|DS694069:151491:179110:-1|gene:ISCW004405
Sequence
TDENGRNHHSFLLLYCGCVLAAITPHKSSRRFPFPLRDISDAVGYPAAEVDLLRRVRPGV
GSRAEGIQFAAGDPESGPSLSLEFGPRADAKFPYRLVLPSVLFRDFALHAVFRPYRAGRD
LPEEGGFARGLSRAEHEADEEFLFAVLNPSETVVQLGLALGDGDSRVTLYYTDVSMHLTS
QRLASFRLPPQATGSHGWLRLSVTATGNEVSLQLLNCTTLEDVRLAQHVTRIPKELAFDG
ASTLYLSQAGPILGGRFVGRLQTLRLFSVPVLVPLCQDTIGFQSDAAPAPRPEPLQQQQT
PRHSGDTEPWKRSINVTAPQATKGEKGEPGAKGEPAALAGIDPDLLFPQETKETKDAEAG
EDIQVLRDLRDLRDHLVPRYDDSTDDDYDVSVADGASSRRQVVTWKDLESLLKSSALMAP
GTLAFVLDSEAFLIKVSRGWRQLPMGALVTWPEDTTESLTHKYDRVIPSLPKLSLE
Download sequence
Identical sequences B7PE76
6945.ISCW004405-PA XP_002400231.1.51680 ISCW004405-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]