SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004436-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004436-PA
Domain Number 1 Region: 182-377
Classification Level Classification E-value
Superfamily NHL repeat 1.83e-16
Family NHL repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW004436-PA
Sequence length 381
Comment peptidyl-glycine alpha-amidating monooxygenase, putative|DS715193:104444:146594:1|gene:ISCW004436
Sequence
MAGTSPGSRAIVFFGTVFGGTLHEIRQIRAKIAQKRVRPDVSLGKSHRQSICCHLFDPLA
AVAAVVASAFRDSRPGEENRLLGRLQSDSPRAFRFLPCLRLHSEIVRLRRAGRLSHSAPQ
IRGLRSCVRQTVDSPSGMNGNWAMLLWQLAAVAAVVASAFRDSRPGEENRLLGRLQSDSP
RAVFRFLPNGTSAELVLGEAFVPGSGSGHFCQPTDVALPPSGLVFISDGYCNSRIAIFTP
EGKHVTDVATRDGLWIPHSLTYVQRDNTVCVADRENQRVLCFWAGLGPDFGFLRSSVTGQ
LGRVYAVASVGSYLYGLQIDDGTSAASGFRVELYPGSRVQTFSPRQRFIQPHDLAVSEDG
RTLYAVDVDAANRKKVYKFRI
Download sequence
Identical sequences B7PHV3
ISCW004436-PA 6945.ISCW004436-PA XP_002403665.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]