SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004451-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004451-PA
Domain Number 1 Region: 162-209,250-365
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000766
Family Fibronectin type III 0.0052
Further Details:      
 
Domain Number 2 Region: 395-528
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000118
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 3 Region: 70-186
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000164
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW004451-PA
Sequence length 528
Comment conserved hypothetical protein|DS730630:3893:35985:1|gene:ISCW004451
Sequence
MEYNLSCLKPWTEYNITLRRFYPNNGNTARPMRIGRAAAVTLRTHAYGKYSHKFYVNILV
KSRSSQPDKKSSIYASWTQLAGTGFPLKYHVRWEPEDPRSGVAGNIELDIPSTRPYDPDG
MNVTLSLEPGVRYRLYVTAENSAEGHNVTFLGPAIFRVVATIPKDPIGLIVNSLSSGELF
VSWSVSGPADFFRVRKYIPIKTSSKGTTSYSFRQLRCFVTPSCSRGSTTPAPRFFVRTHA
PVVVDGGGTASVRSVIVDKLLASQNRSVEVEACSWSGCSNALTKWTMTRPIATPEPVITE
VYSNSTNSFKVTWTFPEDDGSYYDGFLVHYCAKASSCRESYTHKKNLYATNLSAGTSFDI
YVYARIKHLDGLVELGPAARAEVATWKEVPLEPVLEARASEAMSRELVLFWKFINSTADY
LQFAKTEENIWMNCTDDAHCDVAVMHGWTPEFKTGFITLKNLVPYTTYSVSIRGCNDAGC
GNNSTLKVRTGIAAKAESVEWMVRNQGGILVTWERPSVPAGPLSSYIV
Download sequence
Identical sequences B7PK51
6945.ISCW004451-PA XP_002409358.1.51680 ISCW004451-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]