SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004629-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004629-PA
Domain Number 1 Region: 7-208
Classification Level Classification E-value
Superfamily Fibronectin type III 3.05e-31
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 242-337
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000013
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW004629-PA
Sequence length 422
Comment cell adhesion molecule, putative|DS721575:4546:20857:1|gene:ISCW004629
Sequence
MSYIPEGTPTALNYSKGTGDEYVIFWGPVPCELANGVVRRYYLELDSADPWESRLVNHTT
GDMRFGFWNLLPYTRYRAKVFAENDAGRSQVAAELNFTTSPAAPPPPSNLTADQLSRTNL
SLSWRPPYPPQGVLERYEIKFRTNALRSNSTLLNVDQYQCSSENSDLERHCFTVSNLLPV
TIYRFSVRAFNGGTTHGPYSDELEIETGETDKSSWVNVSLTHSFSSSVNASTRPRAVVLE
DLTTREYNLSDLYPGTTYRVCVQASTTAGFGDAVCDLISTRAADPVVPTEPRVNGIVNGT
INITLNSVDFVKGPITAYYVFVVRGSQDVEGPVVPVNFSDAQEMQLGYYTAAKFSPEEVR
ELSDFVLGGGNVVGGFENPPLTDATPYRIGLLVASNFSGVRHPHPHTHKRCRGIMSSVVE
SC
Download sequence
Identical sequences B7PIT9
ISCW004629-PA 6945.ISCW004629-PA XP_002406212.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]