SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW004809-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW004809-PA
Domain Number 1 Region: 35-197
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000232
Family Fibronectin type III 0.0046
Further Details:      
 
Domain Number 2 Region: 216-258,288-403
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000129
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) ISCW004809-PA
Sequence length 453
Comment hypothetical protein|DS706167:51277:86279:-1|gene:ISCW004809
Sequence
MIAHHTTNNATFLTWSSAVEPSLEATLGTHLHGNEAVQLSGYFLTGKSLGHTFQKILNPS
ITEYSLHGLKPWTDYNITLRKFYLSDGDGGQTMRIGRAAAVTVRTRADTPLPPREIKIIS
SGQGKVNLRVVDPIAWNGLPLKYHFRWEPRDPQIGLPGNTEIDIPSTRPHDQDWMSVLLS
LEPGVRYIVHISAKNTGESQNITLQSPAISQDISTIPMDPINLKADSLSSREILVRWGVS
GHAEFFRVNVSCCNENPHFGASSEPRNDFNGFQHKTATILVDGGGTHSSTRSVIVDEHSP
FKNCTVKVEACSLSVCSGATTTSATVRPIVIPEPVITGVASNSTSSFEITWTFAYQNTSY
CDGFLIRYCSPASFCRENCTHTNNINAINLSSDTVFDIEVRARIERIDGRVELGPPAKAK
VSTWTEGVEKRKCLDGLHGRRWMRYGCHIWVDA
Download sequence
Identical sequences B7PG38
ISCW004809-PA XP_002434160.1.51680 6945.ISCW004809-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]