SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW005227-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW005227-PA
Domain Number 1 Region: 4-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000363
Family EGF-type module 0.015
Further Details:      
 
Domain Number 2 Region: 34-82
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000519
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) ISCW005227-PA
Sequence length 83
Comment matrilin, putative|DS721196:9867:10239:1|gene:ISCW005227
Sequence
RDECAEGKHNCEKGCVNTPGSYRCQCPDGYKLARDNKSCLDIDECQANNGGCQEECINHV
GFFSCRCTSPGFSLAADGKTCVC
Download sequence
Identical sequences B7PIR8
XP_002406074.1.51680 ISCW005227-PA 6945.ISCW005227-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]