SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ISCW005661-PA from Ixodes scapularis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ISCW005661-PA
Domain Number 1 Region: 35-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ISCW005661-PA
Sequence length 116
Comment secreted protein, putative|DS768322:812:5403:-1|gene:ISCW005661
Sequence
MSFTSPSAKFTNNVSFFYLLRNSVLSNSPLNCKEVDCDEVVCSSAACTCGSHKSECGCCD
ICNKCPGETCITIHDDLCQEGYECKLKDPAGNIFGGDPGSCVPKTETPHDPAQNHT
Download sequence
Identical sequences B7PQV9
ISCW005661-PA 6945.ISCW005661-PA XP_002436151.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]